# PaCkAgE DaTaStReAm SFWjoe 1 1132 # end of header 070701001a7064000081b40000181b0000000a0000000145245dd80000018f000000550000000100000000000000000000000f00000000SFWjoe/pkginfoPSTAMP=freeware20061004212020 PKG=SFWjoe NAME=joe - Text Editor ARCH=i386 VERSION=3.1,REV=2006.10.04.21.08 SUNW_PRODNAME=joe SUNW_PRODVERS=5.11/SunOS Development SUNW_PKGTYPE= MAXINST=1000 CATEGORY=system DESC=joe - Joes Own Editor a Text Editor" VENDOR=http://sourceforge.net/projects/joe-editor/ HOTLINE=Please contact the owners of this software EMAIL= CLASSES=none BASEDIR=/opt SUNW_PKGVERS=1.0 070701001a7063000081b40000181b0000000a0000000145245dd8000009e9000000550000000100000000000000000000000e00000000SFWjoe/pkgmap: 1 1132 1 i copyright 1198 27172 1159571150 1 i depend 925 12188 1159571153 1 i pkginfo 399 31395 1160011224 1 d none sfw 0755 root sys 1 d none sfw/bin 0755 root bin 1 s none sfw/bin/jmacs=joe 1 f none sfw/bin/joe 0555 root bin 288528 10649 1160008377 1 s none sfw/bin/jpico=joe 1 s none sfw/bin/jstar=joe 1 s none sfw/bin/rjoe=joe 1 f none sfw/bin/termidx 0555 root bin 5660 24824 1160008378 1 d none sfw/etc 0755 root bin 1 d none sfw/etc/joe 0755 root bin 1 d none sfw/etc/joe/charmaps 0755 root bin 1 f none sfw/etc/joe/charmaps/klingon 0444 root bin 10869 40467 1160008379 1 f none sfw/etc/joe/jmacsrc 0444 root bin 23021 41113 1160008379 1 f none sfw/etc/joe/joerc 0444 root bin 26087 28030 1160008379 1 f none sfw/etc/joe/jpicorc 0444 root bin 19910 47372 1160008379 1 f none sfw/etc/joe/jstarrc 0444 root bin 22115 6626 1160008379 1 f none sfw/etc/joe/rjoerc 0444 root bin 22549 52830 1160008379 1 d none sfw/etc/joe/syntax 0755 root bin 1 f none sfw/etc/joe/syntax/asm.jsf 0444 root bin 4166 59896 1160008379 1 f none sfw/etc/joe/syntax/c.jsf 0444 root bin 7556 12437 1160008379 1 f none sfw/etc/joe/syntax/conf.jsf 0444 root bin 367 28828 1160008379 1 f none sfw/etc/joe/syntax/csh.jsf 0444 root bin 3765 32151 1160008379 1 f none sfw/etc/joe/syntax/diff.jsf 0444 root bin 1229 30381 1160008379 1 f none sfw/etc/joe/syntax/fortran.jsf 0444 root bin 13075 29098 1160008379 1 f none sfw/etc/joe/syntax/html.jsf 0444 root bin 2371 38620 1160008379 1 f none sfw/etc/joe/syntax/java.jsf 0444 root bin 3247 46598 1160008379 1 f none sfw/etc/joe/syntax/lisp.jsf 0444 root bin 364 27985 1160008379 1 f none sfw/etc/joe/syntax/mail.jsf 0444 root bin 748 53225 1160008379 1 f none sfw/etc/joe/syntax/mason.jsf 0444 root bin 11953 36384 1160008379 1 f none sfw/etc/joe/syntax/pascal.jsf 0444 root bin 2077 25207 1160008379 1 f none sfw/etc/joe/syntax/perl.jsf 0444 root bin 3711 20166 1160008379 1 f none sfw/etc/joe/syntax/php.jsf 0444 root bin 2616 92 1160008379 1 f none sfw/etc/joe/syntax/python.jsf 0444 root bin 2389 52165 1160008379 1 f none sfw/etc/joe/syntax/sh.jsf 0444 root bin 3989 51116 1160008379 1 f none sfw/etc/joe/syntax/tcl.jsf 0444 root bin 3635 64523 1160008379 1 f none sfw/etc/joe/syntax/verilog.jsf 0444 root bin 3646 14272 1160008379 1 f none sfw/etc/joe/syntax/vhdl.jsf 0444 root bin 2954 24926 1160008379 1 f none sfw/etc/joe/syntax/xml.jsf 0444 root bin 4570 31394 1160008379 1 d none sfw/man 0755 root bin 1 d none sfw/man/man1 0755 root bin 1 f none sfw/man/man1/joe.1 0444 root bin 36868 64182 1160008379 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701001a7064000081b40000181b0000000a0000000145245dd80000018f000000550000000100000000000000000000000800000000pkginfoPSTAMP=freeware20061004212020 PKG=SFWjoe NAME=joe - Text Editor ARCH=i386 VERSION=3.1,REV=2006.10.04.21.08 SUNW_PRODNAME=joe SUNW_PRODVERS=5.11/SunOS Development SUNW_PKGTYPE= MAXINST=1000 CATEGORY=system DESC=joe - Joes Own Editor a Text Editor" VENDOR=http://sourceforge.net/projects/joe-editor/ HOTLINE=Please contact the owners of this software EMAIL= CLASSES=none BASEDIR=/opt SUNW_PKGVERS=1.0 070701001a7063000081b40000181b0000000a0000000145245dd8000009e9000000550000000100000000000000000000000700000000pkgmap: 1 1132 1 i copyright 1198 27172 1159571150 1 i depend 925 12188 1159571153 1 i pkginfo 399 31395 1160011224 1 d none sfw 0755 root sys 1 d none sfw/bin 0755 root bin 1 s none sfw/bin/jmacs=joe 1 f none sfw/bin/joe 0555 root bin 288528 10649 1160008377 1 s none sfw/bin/jpico=joe 1 s none sfw/bin/jstar=joe 1 s none sfw/bin/rjoe=joe 1 f none sfw/bin/termidx 0555 root bin 5660 24824 1160008378 1 d none sfw/etc 0755 root bin 1 d none sfw/etc/joe 0755 root bin 1 d none sfw/etc/joe/charmaps 0755 root bin 1 f none sfw/etc/joe/charmaps/klingon 0444 root bin 10869 40467 1160008379 1 f none sfw/etc/joe/jmacsrc 0444 root bin 23021 41113 1160008379 1 f none sfw/etc/joe/joerc 0444 root bin 26087 28030 1160008379 1 f none sfw/etc/joe/jpicorc 0444 root bin 19910 47372 1160008379 1 f none sfw/etc/joe/jstarrc 0444 root bin 22115 6626 1160008379 1 f none sfw/etc/joe/rjoerc 0444 root bin 22549 52830 1160008379 1 d none sfw/etc/joe/syntax 0755 root bin 1 f none sfw/etc/joe/syntax/asm.jsf 0444 root bin 4166 59896 1160008379 1 f none sfw/etc/joe/syntax/c.jsf 0444 root bin 7556 12437 1160008379 1 f none sfw/etc/joe/syntax/conf.jsf 0444 root bin 367 28828 1160008379 1 f none sfw/etc/joe/syntax/csh.jsf 0444 root bin 3765 32151 1160008379 1 f none sfw/etc/joe/syntax/diff.jsf 0444 root bin 1229 30381 1160008379 1 f none sfw/etc/joe/syntax/fortran.jsf 0444 root bin 13075 29098 1160008379 1 f none sfw/etc/joe/syntax/html.jsf 0444 root bin 2371 38620 1160008379 1 f none sfw/etc/joe/syntax/java.jsf 0444 root bin 3247 46598 1160008379 1 f none sfw/etc/joe/syntax/lisp.jsf 0444 root bin 364 27985 1160008379 1 f none sfw/etc/joe/syntax/mail.jsf 0444 root bin 748 53225 1160008379 1 f none sfw/etc/joe/syntax/mason.jsf 0444 root bin 11953 36384 1160008379 1 f none sfw/etc/joe/syntax/pascal.jsf 0444 root bin 2077 25207 1160008379 1 f none sfw/etc/joe/syntax/perl.jsf 0444 root bin 3711 20166 1160008379 1 f none sfw/etc/joe/syntax/php.jsf 0444 root bin 2616 92 1160008379 1 f none sfw/etc/joe/syntax/python.jsf 0444 root bin 2389 52165 1160008379 1 f none sfw/etc/joe/syntax/sh.jsf 0444 root bin 3989 51116 1160008379 1 f none sfw/etc/joe/syntax/tcl.jsf 0444 root bin 3635 64523 1160008379 1 f none sfw/etc/joe/syntax/verilog.jsf 0444 root bin 3646 14272 1160008379 1 f none sfw/etc/joe/syntax/vhdl.jsf 0444 root bin 2954 24926 1160008379 1 f none sfw/etc/joe/syntax/xml.jsf 0444 root bin 4570 31394 1160008379 1 d none sfw/man 0755 root bin 1 d none sfw/man/man1 0755 root bin 1 f none sfw/man/man1/joe.1 0444 root bin 36868 64182 1160008379 070701001a7065000041ed0000181b0000000a000000024525399200000000000000550000000100000000000000000000000800000000install070701001a7066000081a40000181b0000000a00000001451da6ce000004ae000000550000000100000000000000000000001200000000install/copyright Copyright (C) 2004 Joseph H. Allen This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. YOU MUST OBSERVE ANY AUTHORS' CONDITIONS WITH RESPECT TO INDIVIDUAL COMPONENTS PROVIDED WITHIN THIS CODE. SUPPORT FOR THE TECHNOLOGIES AND DOCUMENTATION IS NOT PROVIDED BY SUN MICROSYSTEMS, INC. THE TECHNOLOGIES AND DOCUMENTATION ARE PROVIDED "AS IS" WITHOUT TECHNICAL SUPPORT OR WARRANTY OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE, OR NON-INFRINGEMENT. 070701001a7067000081a40000181b0000000a00000001451da6d10000039d000000550000000100000000000000000000000f00000000install/depend # # Copyright 2004 Sun Microsystems, Inc. All rights reserved. # Use is subject to license terms. # #ident "@(#)depend 1.2 04/11/20 SMI" # # # This package information file defines software dependencies associated # with the pkg. You can define three types of pkg dependencies with this file: # P indicates a prerequisite for installation # I indicates an incompatible package # R indicates a reverse dependency # see pkginfo(4), PKG parameter # see pkginfo(4), NAME parameter # see pkginfo(4), VERSION parameter # see pkginfo(4), ARCH parameter # # () # () # ... # # ... P SUNWcar Core Architecture, (Root) P SUNWkvm Core Architecture, (Kvm) P SUNWcsr Core Solaris, (Root) P SUNWcsu Core Solaris, (Usr) P SUNWcsd Core Solaris Devices P SUNWcsl Core Solaris Libraries P SFWncur ncurses - new curses library 070701001a7068000041ed0000181b0000000a000000034525399200000000000000550000000100000000000000000000000600000000reloc070701001a7069000041ed0000181b0000000a000000054525399200000000000000550000000100000000000000000000000a00000000reloc/sfw070701001a706a000041ed0000181b0000000a000000024525399200000000000000550000000100000000000000000000000e00000000reloc/sfw/bin070701001a706b000081ed0000181b0000000a00000001452452b900046710000000550000000100000000000000000000001200000000reloc/sfw/bin/joeELFn4`b4 (44cccc Te?ABDEFHILNOPQSUVWXZ\^`beghijlnoqrstvyz{}~  "$%'+-/135679:<>?ABEFJKMNORSUVWXZ[\^_`abeghjlnoqsuvwxyz{}~   !#*,.0135789:<?ABDHILNOPQRSTVXYZ[\^`bceghiopqtvxz{|   !#$ !#%'(,148<@CGJKMRTY[]_acdfkmpuwx|    !#&()*,.0248;=@CDGHILPQTY]cdfikmprt|   "$%&'()+-/246;=>@CEFGJKMUW]_adfjklmnrsuwy}~   "6 \J K `m( $| /@ 8 ?D JnV d0 kDE qL xm ~kX T dW + B <  ,d k >5 o :9  *  ko \ H N,] S+ _ h\ p`{ th @W E P  8  ] C  f ! i ̛ L H   ? ]  }  1B ̉ c ,X& 44* =X C L- UM \ c4K h1B o  Љ @  S L s j 89 ,> / } LP, L Z e#  0 " ( } - ` (4 H ; () A t`} H &5 Q lW U ^  i m y  v  } ܆ G t" 38 }  \  ԓe (  hH , W  8 X  }% }  |s   i   + $ SH , A 4 p|A 8 ` ( J 8* U H `  f @  x n ~ d; H- , v  d]  H $ (x# | h `W , x hh  y u  m <  ( H7L 1 D47 6 2 ; = @ 5 F $ M X T (} Z p b P6 i Z t  y W  n" p X  6 `f  D   d ]   9  Hf i ]    ] L  @ d  ,E & Pf < P' B {s J  `  x r } D   p; x 0&  \   0m n * x `n |V p   \  Xo{  (# d * [` 3 \ <  C  H } P P - W ,1 ] lc o i Y  o   | k `i X$& }  0n# ! [d }  XAY 8 d  m? `2 }   . j  @  ) /UT D̨6 6. ?xPl E kK2 P Xn _WF f`ko u z  pj iX pk   4 }  `jx  4 t K \ @ 0lX @ Q 8> P> tx hW  DV< "Tf /8u 5a < B G@ Q} X a`t oT w% }*# L  `+  H ' T\} D $; n@m} D  =4 ~  & Tt 'V w9 & 3 :L BO, J W ]l f kȵu <2 n< }+ r z!  l    mj@ $ l~ , j l@i @  w   @ }    !`O (' # . Y 8s Xw @;U  GH0 P{ [+ a`W eP rjym$ TM &6 + = a  s ] + 0k\ P RH p~ |4?  H x[ i' C Pl ( j/\ 9 8K8] Q!  Znd@f wP kP| s zd =i  4M ;> [ }  n\ ?  TT   j4 }  8 4 cl '} Pj.u^ 5< <`WF C(8p J Q W(] ^$i g p7X yĹ lQ  ( ._  =  = o4B  m5 ! P| 'D /d <`] C4 J&5 P(2x Y _U kh/ p wx      D  0d  ()  `w ,\Y ij plW pm#0! *T k 4#v >P*] D0  K Z Q Yh4 ``a2 g sjn} xm$  @ (  0 b- hq $f M|I ,|$ Pd jgetstrumathpisbolgrantpthtaddp_goto_eoffdefaultwabortp_goto_eolnl_langinfojoe_iswxdigitpisbowpgotormkmapcposnungetcfreemacrosutf8_decode_fwrdubegin_markingtgetflagukillpidwshrinkvflshmsgbufustat__filbuferrptrlazy_opts_mcountucolucanceluformatdoeditforcebreadberrorparse_identvlocksprintfbonlinequotevalutomarkbbwmovehelp_ontgotopfcolusetabsutomarkklast_timevmemfind_longestcfgetospeedcreatgloptsutf8_decodedata_wctype_digitttflshjoe_readbwgenvsspanendprtutf8_encodeublkmove_fxstatmkmacrodata_wctype_spaceattr_bufpprevluexecmdmkqwnanreturncolumnsudnarwcsmodeinserrnyankeduquotepdupopendirwshowonesigactionvafillunmarksigemptysetLASTmsgnwunxterrumodefilenoputenvmkqwfind_context_helpedloopuscratchutf8_decode_stringublkdelvsmkupgupinyankfcmplt_inswmkpwbwmkbyte_isprintbwdelbprevutagdowriteushrnkdemotegrouppispurestaenrmsrchjoe_iswctrlnscrlupmatch_default_security_contextnotiteatoicurmacrosyntax_list_environupoptgetstrfcmplt_abrtsscanffmtposmsgoutumdnarwwindiepiseolblankumeofsigprocmaskmkmenubwresznon_utf8_codesetumeolpffirstjoe_reallocexecveunextpos_PROCEDURE_LINKAGE_TABLE_gloptsigjoesetitimerpclrrectvcloseticked__fsr_init_valueafterposprocrccalcmkpathbfind_scratchbyte_isalpha_guesscrlfwmktwjoe_iswloweru_help_prevaddcmdvandupget_word_listttclosestrdup_xstatwrapwordvatruncumbofparse_wsvsrmupshfseekpisindentbwrmumbolpnextlmerrjoe_mallocvadupbyte_isspacesicmpisizfflushupicokillbyte_isalnum_rmcapicaseuedittickoffpprevumpgupmenu_explorer_endgetcwdfcmplt_rtnbsaveget_contextnescapeaddmacronoxonhelp_actualvsfillbnextu_goto_prevtermoutstrrchrmpxmkjoe_iswalphaautoswapjoe_towupperumsgsyntaxeschdiruredolseekubeepint_minjustkilledget_encodingsvbaseBaudu_goto_leftpextrectoptionsbmkjoe_iswgraphguessindentdofollowsustopplinedeadwprevbaudfclosemkkmapuundouplaydata_wctype_punctto_utf8obufpuduptwnstackjoe_iswspaceunedgepgamnt_GLOBAL_OFFSET_TABLE_unotmodchpwdgenexmsguyankpopfindbotwuexpldto_unibrchupedgedata_wctype_alphaerrnodesunaargpinsrectparse_fieldparse_charulosefchmodjoe_iswprintulineu_word_deleteubkndsquareuctrlp_goto_indentsetindentset_attrjoe_set_signal__iobpeopfrrecshtfindisregpmatchlowerizefcntlprgetbjoe_localeupcukilljoevsndupprgetcbinsbytevsdupuuparwumarkbskiptoppifindutoggle_markingclrinsuprevposcmdhasheraeolborphannresizeumarkkpnextpdelrect_exitjoe_iswalnum_u_goto_bofugomarkutypebwbrcdata_wctype_graphu_goto_boljoe_callocmarkvdata_wctype_printunbufmmovetickonu_goto_rightbrmdostaupd__1cG__CrunMdo_exit_code6F_v_msetoldtermbofflinepboptcompilevaensurebrsjoe_freeusaveucentervscmpnwaitnclosemarkstackuupslideutosvamkalenscrdnmksrchrecmacpfwrdumuparwupdallrmmacroublkcpy_edata_get_exit_frame_monitorvtmpnonoticewnextmsgspurity_checkerrnoprfinducmpltobufuuargwshowallsresizefopenleaveusplitwuprverrtexecundomarkbyte_ispunct__longdouble_usedutf8_initpdupowncopy_security_contextoutput_security_contextuasklocale_map__deregister_frame_info_basespbkwduexsveuquerysavebwfllwparse_stringassume_colorscrexeclunlinksetcapmap_name_cmputw0utw1pdefaultlines__fsrscrinsparserrbdeath_fduisrchmcntlastpatsignrmvarmttputsupbufnopenjoe_towlowertgetentmemcpyjoesepvarsrandomfind_a_good_bwyankbuffind_indentmsetIuswitchedupdexaskuabortbufkaddpopenreset_default_security_contextorphitdata_wctype_xdigitmsetPubkwdcfindtopwrtntwmkdirhtmkobufsiz_startsaverrreaddirmparseslenumacrosfdopenquotestateclosedirdata_wctype_ctrlmathhistmpxdieduopenjoe_wcwidthumarkltgetnumget_highlight_stateexmacrofrchnsetoptpsetdspasisursrchutxt__dso_handlepcolivflshfmaintdumbattr_sizeerrbufulindentgenexmsgmultiumltarwmkkbdaftermovefrom_utf8urecord_lib_versionidleoutuparserrprifindnamepartmarkfreepipefindhistpcolwsedefentryumtabwrapdoinsfjoe_isblanktxtwidthrmatchponlinefind_charmapttopenuabort1uquote8joe_iswdigituyankdoswitchITEMgenfmtundoinshtrmsigsuspendbrmemumrtarwQUEUEfriioctlfprintfueopbinsbsigaddsetbinscnegargctimeerrorsudelblstdbufcurposbinsmsrchstrfmtlenlastisrchunictrluyappttgtszmktmpgetgrouphbsavefdudelchnpartialp_goto_bofbinssmidbyte_toupperpclosesetsidhelp_displayp_goto_boljoe_isspace_eofu_goto_eofvstruncpcoalescehaveu_goto_eolmkstempnpospcolusetmarkubopubosudropgetenvbrvsfindcmdalarmjoe_iswalpha_strcmpdopaddingdata_wctype_blankmtextdopfnextsetlocaleudelelwcreateuabortscrdelkmap_getcontextucopywredrawubacksttsuspinredoqsortjoetermubackwmeta_colorufwrdcttshellptabrectsnprintfscrupbackpath_DYNAMIClightoffbcheck_loadedufinishfgetsreplhistumbacksbegprtparse_kwsetpgrpnamprtcountmaindirprtrmkbdupgdn_finiinundotcostjoe_iswpunctokrepluretypfrom_uniu_helpufmtblkuprevwvazapuselectbfindstrcpybrzsnredrawvheadersttopnngetbufsvsbsearch_etextmy_vallocwithinubufed_vasetabrerralitemoutatrbloadterminublksavelong_maxudnslidebfind_reloadparse_intprmgetcapsimple_cmpltparse_rangep_goto_start_of_pathucrawlrprfirstuinscpgetbpisblankpgetcrunhistcmdhistuinsfpackscmdstcgetattrfrposmainenvmagicuupperglobalsrchuns_minlong_minvsensureload_dfaparse_towsfwriteundomkucrawlldoedit1dokeylindent_checkbcpyjoe_iswblankhelp_initscreateudellnurtnlastwnscrldndelerrparsensmsgnwtpofflinettclsnvscmpbyte_tolowerdupmacrogetpwnambwinspfilldoscratchurindentubyteurunsleepugrowwbuildhistpbackws_Jv_RegisterClassesubuildumpgdnttsig_lxstatmksavereququerygenfieldparse_charmapexemacpfinduloweru_goto_nextmkqwnsrunextwttgetcwgrowforkjoe_writechmacpiseofsetlinejoe_iswupperkeepupvasortufiltutomatchqw_smu_help_nextbdelpiseolutype_utf8_sm_vssetutypexlata__register_frame_info_basesxlatcvsncpyasyncsvawordsundodelrexpndwatommenuvsscan__fpstartgeteuidpiseowtcsetattrundormunlockptldmenuutomarkbkmcompleteuhomemacstauswapabortitregsubushellpqreplnobackupsptsnamemacstkyankwherenscrollumclearatexit___Argvpisbofwfitlibc.so.1SUNW_1.1SUNWprivate_1.1libncurses.so.5/usr/sfw/lib:/opt/sfw/lib:/usr/local/lib'= qN aoc ~c c ,f F  hc c c c 4c ~c c c c c |c ?c Yc c d od d @ d d +d Dd d  d $d (d ,d 0d 4d  8d PC)PT+5  ~  @CS )ЉC{ e[^_É)QPCP2붍vUWVS ƉӋ@ U9Ћ}t RMF RWu PT+  ~  ~ @e[^_UWVS Nj]O E 9ىUEu~g)9|Eu؉E EEe[^_SQPPuSW ))ƋGEUE)ډuE Ue[^_ZSEG)ȉu뚐USQ g g t=AˋB C CC [؋]É g jh|g XZh5 cqCC CC [؃]Ég g @g   g Bg ÍvUj4hh Ðf f f PBf Bf f Bf uÉ f  Ë f f  f Pf  f @f f uĉ f  ÐUWVS EXUC J;Ht9Q G +Q+G ~2C;Ht"qQ F +Q+F e[^_Ãw5 SjMQþB+B )‹G+G )Uډ $M8 EP@uSH+H )VEP+ GB ~ WH P= U9UZJvv5 iËF+F )ljډ<$ MQAWSj EP+ FB ~ VH P5 vUz 9ӐC9tWU;Bt;]{ ;]ډESH҉KuqUS ;]tv9{tۋ;]uMYI(ESH҉Kt+  ~ H q5 hC;]W+  ~ H q5 RhC_vL$tZA0uUQt+  ~ H QPh h Ah   h H h ÐUSP]CHCC ;} C(C HQg g Ag   P g 0XC9 usXCuOSPg Cg g   g g ]à sC P룃 P#;} !vL$Qt+  ~ H AÍvUSQ]St ؋]ÉCp5 hfC؋]ÍvUVSu^S;^Xue[^ÐUVSu^ S;^ue[^UVSu ]9tOFSCNF ҉C Ku@VtTS+  ~ @ FCFCF C F(C(e[^Ð+  ~ VH uq5 xeCUSP]X@,@@0BSP  ]ÍvUWVShhg Ӊ謾Ɖ$ ۉF(QhCXVXPR j,jF,PeJdžFdždžF$dždžF FFdžF@[ ^Xs{C,C0w5 1dCF@ @@@ @$@($F @,Ë@+  ~  H GCZYp5 cN CAP+P )ЉA EAE Af f A(Ff dždžpXv5 5f  f zXv qe[^_RhFXh PBUZYjjUÉUWVS ]} d@,@x0 ^ p3SVu 7e[^_ÐPV[7e[^_ÐUEPrPkÉUEPr POÉT$B@@19BtÐB uËL$AP+P )9A ÉWVS|$GHX )ٸ)ȋW 9¾t 9|W [^_ËGvUSP]C@ K;HtFC+  ~  C KH q5 aC]ÐQ+Q )ЉC ]1ÐUWVS U ]҉t_C(sK V+V )9toV 9|@F)ЉS< t9yCM { uȋV+V )9ؐe[^_ËC< uC‰sV+V );E }KK u*N V)CC)ʋE E FC Sue[^1_ËK A SmUWVS ]PCJK V+V E)9tiC} tuC} u~S YursN~ ))ȋS 9tb9}JCK V+V E)9u SC} uCC C(vEe[^_C(e[^_ÉUSS]S*Yu(S: ZtCt t 1ɐȋ]à SXZjS$ t SX1SX뻍vUVSu V_ v SoXZS$F讦u׃ S.tSE^e[^S2^e[1^USQ]C@S;PtRJQ+Q )ЉC C+  ~  KH q5 ^C]ÍvC 1]ÉUWVS}_UvGJO S+S E)9t~G} C_} u}W ^ubHu_Ks ))ȋW 99}JGO S+S E)9u WkqvG Ee[^_À} uO ȋ[x)ӍG ك G(WEƃt%=t~%=%=%=%=ƀwvIGG G(/EW8%ZuY W? ƃMuҋMuVjsUt G(t^ tvG ]tX˃ErEcETEEO GXxș)ӍG QG CUSSË@ tNPS CH 9}CK< C(t#ЉЋ]Ë@)SK< C(uK؉ StċC 똉USP]y‹Ct tЋ]ÉWƒ tBt SW ЍvUVSuV6Zt e[^Ív V{É4$1҃ e[^ÐUVSUBHu e[^ RÉ$!Se[^ÐUWVS } ]tZC(S uT Sgt9KQ+Q )9}uS tՋC+A )SCS).u1e[^_ËKrs A K9ƉE| A+Es< tOze[^_ËC<0 uKS 븉USS]U C9|"؋]Ð)PS؋]É)RSvUWVS ]C(s Su0Kyuus S )SSJuۍe[^_ËK~B{ ‰CA 9ljE|,A+E{ uCKu؍e[^_ËC8؋s S멉 t@tփ SȉUS]S(uC C(؋]à SC C(؃]ÍvUVS ]sS9s} S9s|e[^ÉUWVS ]C@t St]e[^_y SƉ$)4$NjC9F|(WS*WV]e[^_VW4$C9F}VW4$C9F|UWVS}WZPEY^SSk GVRu e[^1_ÃGuRt W3Zt̍e[^_ÐUWVS}WW&XZSES GVRu e[^1_ÃGuRt W_t̍e[^_ÐUWVSu} V?$y S9uF9CuS>Ye[^_S*1Ye[^_ÍvUVS ]SƉ$ v VCXZV$C&u׋^ V^e[^UVS uV$ v SXZS$Fʜu׃ SJtSaYe[^SNYe[1^UVS ]Su H t u! SiSD9Yt tڃ tՍe[^UWVS ]CpCpx )E)ЋK 9txI)C0< tfAC< MK tbUB+B )C 9UtuUrR ))9t+9}C뵍v S Ste[^_Ës Cxx)׍>UC B+B )9Uu SlCK EqvUWVS ]s{ KvV+V )9tsV 9|PF)ЉSGA C}{ uC(V+V )C9C tL؍e[^_ÉC8뵍vsFu:{ KF +F) KSu붃 S릉{ KNUWVS ]Ku A 9pS)9}y G))99t|/9~ v S9s Se[^_Ð SS9} SS9|멃qSKy G)Sn)l9jWSMSUPS6kvUWVSuVF@tzV IFt  ^ ;;E N AFN P+P )9;F;E F FHX )ٸ)ȋV 99hFc VSj譃^ ;E  V2E 9F to Vt\ tWFt t uF^ Hxؙ)띋F^ Hxؙ) VPe[^_É V^ US u ]SI S t t@t S^؋]UWVS]S CHtSE 9C }@vSZt/ t*Ct  SE 9C |Íe[^_Ð{ ;} }CPH )ʉE)Ћs 9t9|KC tCt  t+NEK P+P )G9{ t9C됋C0뵋CHx)ύNEK P+P )9{ uǃ SS{ CE S S C{ s ETvUSSË@ t.PS CH 9|@S)]ÐC]à SC vUWVS ljUwN ^)؋W );E},)ًE)ʃ UWnuÍve[^_ËE O V+V )9uރ W9e[^_ÉUWVS Hz9ÉUp Q 9|}A)ЉS< tvFs Q+Q )C9tyt8A +AC CACSs ulEKx9uɋE;p ue[^_ÍvC<0 uFs Q+Q )CC9u S[s EKxt94롋EKx9!뎋p ;r 댍vUWVS(uhNj@@ p+w9u*U҉u5tEWaE^e[^_ÐWN^e[^1_ÍvG(PhhP1U1JvM C9uU+u]vU)BNx]tK@KU :t*G+H QG@GPG@ P*WB+B +5 ) ~ S M@H   ȉẺCẺ]̉<$U B9G>M A ỦUċ]ȋEĉEȋUčMȉP WRVMQM AM+APM AM+APNe[^_p5 KBƋOG ;A Et WPBW OUPU B +EC Pj AGP". Cs G@GPV(+5  ~ M@H  ẺCẼ]ĉ]Ap5 AU ƋJ B;H t RUQPM q j q|-CU B C PrV'(+5  ~ MH @  UUWVS,}E HW9t81)EMu3WZ(4QPwr(<G@ e[^_ÍvU OR)ʉUU GJ9U R ҉UE_ @E؋G@ U9PEM Eԋ ~ G+E U H BGB+EԉO M؋J@ 9G bEQ CACMuK PEU ABA QE Hq+q GE܅Et W4juwwN uwGp趷9teW9t9SuG9C~C(9u9t8SG9|&E9CWSv9uʃ W^XWuuEWZ( P;Q t E Pup5 Ek>U ƋBp rV8%M QB M A r j E pR*+5 U  ~ BH @E HA+BAA _ ۋGo;X Et WSip5 E=ƋW+B PBGPV}$G+X UZ Sj V)MA )  ~ Eԋ@H WB+ABBU JjvM A9Ct0+USU)S4WSP=XE)C ȃWGpMO ;H t WQVp5 E< uƋG@GPVr#ME+5 A U ~ Q@MH GH)PMGGXZ qG+  ~  _H s5 ;S+S )֋WJ Gw Q5 A)G ~  ) J @ GAG A ]UME‰ @AB JISPSE K]tPEHM죌 ڋC JvU  bEUUQU =UVS uVgà S# t t@t SVS]e[^LUWVSp^ KɉljUUP;ZWYG P ~ wOU]FS+ CF2V5  u_  H s5 9Ge[^_ÐUBCFJ PuBFB0C+ J   ~ H C p5 y9CGH AP+P )ЉA G+  ~  wH [Xv5 29GG e[^_Ð@\EGG+  ~  UH r5 8GXZWGpGX C+ u ~  NKH ^Xq5 8CGH AP+P )ЉA e[^_ÍvWEH]𣌞 BCBG+ J   ~ _ H s5 8GXZWGpe[^_ÍvEp5 7EwG ;F t WPwP+FPFGPuG+Xu ^ Sj u# MWF))B ~ Eu@VpG)B 2UH 9tZΉ] v9tJG9BuB _ 9|MJJt!+M] H EB@ _ B )؉B 볍vMuOwG UWVS ƋEUt V,juvvE4$PuvFpb9taN9t*9KuSF9 {,t9uC(9uٍv9t$CV9tR9.K,t9t#v9uދFx(ug@ e[^_ÐECECE 9CűEC ĉK,uCtVS룃VSP_SuVp( F@ e[^_jUWVS } G Pu WeEe[^_Ív uƋGP_ C G Pjjp84$V WEe[^_UWVSLEu EuEe[^_Ív u%PEB+B ;EcMY EȋMuME ẺE v5 ZYp5 ,4}ÿ}PWuS ~ FWj S + FE ~ H @ẺFMȋẼ})} 0u^uȉ2EȉPE SuuuċEUYuu%Ee[^_ËA@;PRB+B ;E QE P@uVq EUEWMQPVq EE Xuj V CELvUU UMAt tPjEPQÐPjh8QÐUVSM u~5VXt(Q]Sd` PSVe[^ÍvVMt tPjEPV^e[^Pjh8UWVS } ]u uUv9s }-WSU$C(u߃ S9s |Ӎe[^_Éj S$C(t'K 9}ҋCxx9Eș)U9u~Ãj SˉUWU 1IQRuy}ÐUWVS uEu e[^1_11P)PPu:M~9| e[^_UWVS~tZe[^_ÀxtƀXu뿊D4ǁP  S$$=u[ uRP-=P S_P|P)ƒ҉Pu5  @1= D@ jC4Y[LP4M 3DžHPS ^t@4B| ǂ4@$@ 4G| LJvUVuStX>tSf f t#CtPVtrf uރ Vǀe[^Ð j XZh9S ǃ뭋stC ǃCUVuS>f f t'CtPVCf uڃ jdYXVS ? ǃ4$膰Cǃe[^Ð j XZh9Sل ǃ뭋CtC ǃCUuǀÍvUVuSt8>t3f f t%CtPV tf uމ1e[^ÉvUWVSjf f tSCtAt~;~uIPX*Psjj+P1tFPVƃvf ue[^_ËD s*Psjjj+F뻍vf  Hu =f u1@ÐUWVSuIv)PRNQu ?xoPV+BPBFPu ?xL )}VF^S +CN )ȍ;}}@9|PWCN+C Pu U?yV舺 [e[^_Ë}tSC 9);E}\RPNQu ?xPFP )UF EuF@FPu >xV 1[e[^_PuNQu >RVڹ1 WuCN+C P딐UWVSTPPPu DžDDT;]H}]H]9HjPu h9H譬YH'gX SPtRjPSD$LwWuVS&ZYPu u=h9Pq 04#YHȢ e MuPT u8XEZHPVƅO :V| t#PjOPS蔪$;V_uUB@tPHتXRPHjت}}WEBl 0"_XHh 9@PTrv SS h 9HDžD?  UWVSE }EuƋNA +A+F 9};vPVSuv 6]4$)YNA +A+F 9|ȅuV辵XE e[^_PVWuv V藵XE e[^_ÍvUS] CPm: SPu,]US ] Sj$ SPu]ÐUWVSuu} É$CU+B9}SVWu7e[^_UWVSj}ި hhh 9TѨx(h9Sʨ jcvXRPh 9j謨x؋l%=u螨9tuj h 9WxhP耨m j놉 TPm PhSSnVWhSSV$辧5f f tVN t:Ft7RPh9S"$芧 F pPSZYPvO6Sjjh$9Ņu j9 jSj0jhTΧcL$D$ T$7 JJJ JJJJJ J$J(J,J0J4J8J<@ƃw3$'J8J4J0J,J(J$J JJJJJ JJ D$ÐST$L$ D$8v JJJ JJJJJ J$J(J,J0J4J8J<@ƃw3$'J8J4J0J,J(J$J JJJJJ JJ [ÉUWVSPu]E E wP$$(؃)ƒtowe$d(EGEGEGEGEGEGEe[^_ÊECECECECECECE<)։PMȉЉPW"lj w$(ECEC EC EC EC EC ECECECECECECECECEe[^_UWVSD$9D$t$;D$L$0Ӊȃ9lBABAB A B A B A B A B A BABABABABABABABA))3$(L$9‰˃9uovBABABABABABABABAB A B A B A B A B A BABAT:L9$(CFCFC F CFCFCFCFC F C$F$C(F(C,F,C0F0C4F4C8F84:9VK2Hu BAvD$[^_]Ã))ك)߉ΉӉ))9i@C<@FXZ+F$VBPWP@EDv WGuCPuWv|.E@CM |VFBH9Gu WV$FH9AvCEV$FH9FX)] A] Ӌe[^_ËA< Ev0NjF|@xW9f WQuWv|-E+F$VB9Gu݋@M |Wr8)RWк막UWVSE }MMEGUMXwUE39} 9vUJ1;E~~;MyE));uP]CSjGUW$|)R O$GMMG@)‰]E Ue[^_e[^_ËG@ ;H]MWEG$U)؋RwuG$0REEU+BPM1nGwERVjGUW$|)R1GHUG))ЉEG$EGU)E Ee[^_GESUWVS l$ D$(D$EH]|$$$T$,9T$~ 9v$pW9}9$$T$H49}9$P9~9$P 9b$J919)E@ ;pT$9K)Ήt$,U$D$(T$$ED$ [^_]E@ ;pu9}9,D$D$(9\$(D$$E|E$D$ [^_]vED$E$)ȋ|]vEE$)DE$)|D]EE$)ȋ|]kv [^_]É))É\$(D$$E}$|)ЉD$ [^_]D$D$,E$D$)ȉT$(D$$)։t$(UWVSMȉUUREQEEE1UEEE9}(t; uDÉ$~ u(SE,p|(D $UCMAq X 9@PI)))Ӂ;}E4q m;} | E;}$|EE  YMA@E};}Ktq}3uE}(tEUEEMAt < y} @M 9MPE$9EE;E;EK<PEP5Pj9EE7MAEKu/Iv;EUBPE)t׋U: "MC=UBPx :tљ)tE 9tvU$9tEg[t@tJDz u萣UMBIX MMEWCMEE.EH;EUB@)ÉM uMUIBMX U: EEMAE9EEtSuuu?EMUA+QH 9fEP EUPEe[^_ËMAMH um[MIMUBU: X =Zv@))‹MQ 둉+u<E EPWEuM uREPuċU,BL]  +EM9MNuK}U 9UfM$E9MSE< R< UBxh};}U9U}BE EPj>EuM uREPuċU,B肶EM 9M|5] UM9M0MUA+QH 9EP E UPPw15E))ƿ u詠MUARX U:UUM+UAxxЍ :);M ~;M$EEUBU+UUHxЙ)ֿ @))‹MQ 2WEPE1Pj!5nME EuVEuM uREPuċU,B }~EKI;EaUBPE)tjMCQkt]XCMX}vUWVS,ÉUԋ@UPC+S$@ 9P}u;9}عfE1tQvjPuMVREPu C ]  uD5؋UFD5؄ue[^_ÍBPhB9j EP薌념UWVSXuE EEv 蟚EV$NFʋUEEEEEE$^$t} F9BdW F EN@+AV$~GEEċ`EEEEċ\EEE;]܉EuVBEUSRuUEMċ|u:~GCEE;]] uMuMċ|tǐNA؃+F$V PQEEE؃<NA؋V$);E| ;ErVA؃ )PVXPjjvuV FPRuuڋEHMċ|~GC0EE;]3F V$EEċ`EEċ\NEG}EEӉЉ}WvEESPuU}ċ|N MV$NuFF@EECЋ}G+A9] uEu}ċ|tvA؃)PQUEEEE؃NA؋V$);E| ;EVA؃ )PVPjjvuV FPRuuڋEMċ|~ 0V$N} @ 9pL @ 9pLPvj}ċF$|PvVF@؃ +F$PV3PuuvuV FPRuuڋE!}ċ|V 븡} } x$J$@R}ԉMEẺUȋdW + u荓]EEe[^_mVF@؃ +F$PVpPuuV PVSPuuvuV FPRuuډB|0F V$NEe[^_ËN V$M } ^F9ARF Y9XC=} t~q$p$EXZ} p$F p$E_X} pF pEY[} pF pEE} @REԉUSpEXZ} pF pnEVvT$D$P T$ P$ÐUVS]uS9}NK$tFP)PjC|RwS )PjCS$RSE Cse[^UWVShu }SÉ8EsuHGu h] u:@C$GHCu8 vCXvߓKC PGC$GCtȋCdžC@0C džC @0GCǃCAXQhPS(R誃C`t@G C G94Ct4C@$C @$ǃe[^_ÐG C Gă wDXsTW$GD먐US]sXs XsT]]UVS uv 轝tsPpY+PSSSFpF ppP(P BR@@Ph4TjPhW  0hW 6e[1^ÐPF ppX(tKP BR@@Ph|TjPhW  hW 66e[1^ÉP^XF kPNYF UVSu^V B$PRΥF X$^e[1^UWVS }WG9؉}ÉƅuG p$t%G P$)RPiG )p$)_[1e[^_ÉUS ]C@@Ps WXCZPsD]U]  ] ] @; ] t1c1ÍvUWVS @ pL@H@)}EtFG yWF H(ɋX$ts;X vt^ K(C C$W t0Et)]  ] ] @; ] )vEe[^_à PPF ;X W Y CHP(g@FA @H@)tFt Gvu A pLWE~ tH~ ] 1uj W@ pLu@H@(Z0u A @H@(#@} WjPe[^_É v N} t<} t6} t0} t*} t$#} }  E ESjEPF91ydW  sLD `W `W $`W  S臛F @ WW} v q r?W?WmEh!=6 W ]  ] ] @; ] xWvUVS hW 11ۉPi Pi 5W F&u؍e[^ÐUW tu5W xÍvu5W ZÐUSjáW tH u=} E CCC CCS35W p]뱐UWVS W t5W uAIe[^_Ãhj[W ËEvBMUuCDDuCuj UWP1U `R\PQ5D ,EE HmvUSP W ɋ]tK\ QK)Ѓ~0ET7B< UF>TЉU7 ]jjjjE7 7 77ƒ0ET7B<wFU>DЉET7B<wF>UDЉEE7`7 WPjjjEUe[^1_ÍB<vB<wFU>T U렍B<v B<F> UE2"t='tDB^v(\Axe=AAe=AÍvAÉA\"AÐA\'AÐUWVSEt+‹@t+R 1uUBFE9p u[^_ÐX tUB0`=wX tdX EXUֿ`=ur5X uX "X X EX X [^_Ë=X uX ,EXX Uֿ`=tU1:t, X v0 X EAX X F<0u݋v=tD{=t4=t$=t=X ,X H X @" X EAȉ X X "X [^_áX "X X lUS]E X X X  X tX "X @X [ÉX [ÍvX t@P t @DÍvUX uÉ PZYPX pKÉUSX jX  X ]UWVS= X 1]EEm=X X  X su%SJɉUtEUB1U EO] vS1X E1ɡX 5} ۉEt]{ tW}tO9K tD] u:u6SȋjAPX  X X ۉE X u} UX 9UX  j95} O] u ut ] tuM t虔Ee[^_ËCESUB @ @Hx(3usEOfv] uES֓g PEbUSP]QjS]ÉUVSEU tr1 wV`X u>@ u j yjjjjCX sX 1 e[^Íe[^à RUU BЃ MwjjRQYPjjjh j&hU11 UX VSuI҉t:N X Xw X uGF҉ X u] Ve[1^ËBP JP @4X 딐 PX NF҉ X t hv=PjjF0PS SgUSPE] tCЃ wLË`X u  X u ]Ð`X jP`X ]à SUWVSuv ~1ۃC tn X tPWTWv /Xv N~C0$Ph=h,W^Wv Yv "~XZj v ŸXv CTt ue[^1_ÉUU BЃ MwjjRQPjjjh, jh=1/ UVSEu] tSV}fE fE m]mUu% SX  X 1e[^ÃP6ZvU5D jjhAjjh jh@UE0%0ÍvUSPU -]BЃ w|@ DBУ@ ,  5@ =u=Rh=h,h .]SjjhT h  Ph E0. ]Ãt;t t u=t]1=, , \@ tU? RN@ uG, tJX tX  X t1]@ X , X 뾍vUU BЃ M@ , v,-t'PjjjhT jh=1q- ÍvjjRQAUSP Z {tCH@tKLu 9Z u]à QЃ vUVSXw utd] Xw EPEPE 9APuu1mX5 x@ 0<X5 , Y {t#CLt CH@ui S Q 9uSB@BPQ B<B P1i]d] e[^ËEe 9A9QVsLЃ뉉USR]t tX X X[ÐUWVS u1Et# H AH1ҁx(EA\v] X t j4X u] u X X X X  X u P @ pDhá @ P4t9t@DHHRDɉJHtDD4 Sǃ] &E@te[^_ÉE ݍvS PX  AUWVS,EE E 0$=WtPh\ h=SV h=VtPh\ h=SV h=VtPh,] h=SV h=Vt \  h=zVt 0]  h=\Vt\ jjh%jijE h=%V POPSjjj1h=tCPSà 1tGP1WtCPS|j1h=tCPScPu؉<NP Sjh=jj(à 1tGP1WtCPSj1h=tCPSPu؉5<t`NtPSh>hآ @Ve[^_PShtUhآ "V$آ U h jEP3VE`^_P5  X BۉB { X uGD PrphUh,h U_Xh 5 @L^0q j[5 Yu#X %1e[^_jjM t@P#)FxtDujjU t@P(FU yv8+8-t M 4 X  ɉUt UЅP5 ,E̋Eȃ}̅E̋PM̋EAdy(td9u4^jWM tBP)(YC W&9t&E :+uōEQPh%>BPCR9uڋE̋PBXRhWPQM̋AdQEЃu  P }7EȅuM̋0vE܅~HPEp AtE1FU EЅF 5 `W `W `W ARPh)>hآ aR1WE 4h.>hآ ARaxv1@EBE`f M1hآ j%jhUQŰ PFFf RtphV PC9| HC [[^1_ÐS [[^1_ÉT$J A;J}J 1ËD$P B;P| @ 1ÐP 1ÉL$A tHA 1҉ÍvSD$P H9ʻ|)ʉP 1ۉ[ÐWVSP\$s {)։ыC>9}.9|tHC 1v_[^_Ív1S 1C C _[^_ÐS\$C @ЋSȋC9|))K C1ɉ[ÐuC 9й|љ1ɉS )C 1CщUWVS D$4H Q,T$4R D$4XЉT$D$D$4@tD$T$ƋD$4x$D$+D$D$$*9<ōD$D$L$4;D$Q|SD$tcD$HA v1 [^_]É9|jjae[^Ív9u ݉K9t{/u SľPSjj*e[^UWVS u'Dye[^_ÄtŊ0UWVS ]ta1߹у yWNShK>WPCVCǃ1thW0C<$Ce[^_à h]>Aub>낉UWVS ]u ƒ?$*CF8t1e[^_Ð[uCE^E]t,C]t#Uv-t;9tMt C]u}uBMt>tF?^C鐊K[tt8Mr8UwE몋UtHvC>]tkE]CEE1>e[^_CVSu FuL$1҄t<*tEBE uBX h>tSu!^_tNjMt Ep;pudS,PSjj蒼UP1tUBPunE uAu uAEe[^_ËU DS辺PSjj$UBE롐D$t8u1@vUhhX A\  w w tAQPw Aw w   w  w w w UWVS w w }u t9z tvjhw 7 ZY@@PVzPXsLw Cw w \ {   w w tF@\ e[^_ËBt@+FqVrLEe[^_1Lw  sJSPw Cw w   w w e[^_Ðw =w T$t9P t @=w u@ @UVS]3 w =w t_w tWP҉w t@ tڋ^9C uF@L@ @9Btċs ^LIS A9BtQs Ke[1^Íe[^ÃxC u S w ^UVS]3 w A=w tWP҉w t@ t^9C uF@L@ @9Btˋs ^LIS A9BtQs [Ke[1^Íe[^ÃxC u S  w ^UWVSEE0E U+^ۉMy9)ЉA^)‰ًE)ыP B(Mz9J MI))ËB(KMTB )؋MAB(MYB )+EFtw;wuL3"P3jj臱P1tGPWkEE 9Eue[^_É D3ϯP3jj4G뷍vUWVSu} v C$QYv TXZv Sh 1tGPWv MtXv T$@^ {(tC C$e[^_Ð SQF @ C$e[^_ÍvUSS]tSuP$]ÍvUS ]SE 4@0pLXu觮C<X31]ÉUWVSEp B$ PUXr B$S_XC+FPVq4$?$?1tGPWjj误 @;BDB*BQSU 1tU BPu Ɖ$խjWjjh5h5VE0 E~~ t e[^1_É Wu uYUrCLC\$`MɸtuuWUrLUe[^_ÉUWVS]@0s{ sE$ҿtWEpLփe[^_ÍvUWVS ] Sjj}w4WWhx w^ tb pJ$"FL0uu jjCECECECEC Gp C؃ e[^_Åt1UWVS ] Sjj}w4WWh@x w辱 tb p誴$肾FL0uu jj|CECECECEC Gp C؃ e[^_Åt1UWVS ] Sjj}w4WWhx w tb p $FL0uu jjܨCECECECEC Gp C؃ e[^_Åt1UVSu\ VsX,t<u j Uá\ 4$+C\ ƻCe[^ËCe[^ÍvUS]sPCTXsXC\uD C\]ÍvUWVS1DŽxGu\ t}EXpu stUC EpZ:_XjjV{1IQsxP! uq VM7uRh]h@ XSQ*$1 xG茥ue[^_VhSp*Yp뻃 V6 ؍vUWVS,\ EE x t.1ҋx wx -@ x (x u\ E8-1t5ux %*F t b }Y: -31$:WhPPSWVMƋuu DžhZhآ *u h hh@ P 1҃t< t< t< t BuƄ\  P=\ G~{u hZDž5 VhRD hآ jjhGe[^_À}PhRzuԀ}u h8[Džp1Ʉt t A t< t< uƄ M PB-(Št< t< t< ttBuƄVPu蠨@ Pu hGhآ > Dž tB뀻CP5D tƄlGCP5D `uF5P5D Xt59މƄ5R5D WP5Pj蚪PP蝖hhآ jjhGd11Ʉ   A t@< c< [< uƄ A ˄t< t A ujƄ SW Wu hGhآ Dž( GCP5D uቝP5D t֋9Ƅ=" P\ZYP¥G)CP5D uቝP5D t֋9Ƅ=SuHiDžDž@ u ht[Džu hGDž< u h[DžpHTCP5D uኄt2< t.< t*< &Bt< t< t< u耼 uލƄPXu h[Dž Dž Rw u h[Dž>u h \Dž! Su hHhآ  Džu h8\Dž UWVSE uM]9\Ut#uCAMK]E ue[^_Ã~؍q{u}A0Hw6$+EPEP‹]E uMe[^_ÅuN_M넺 _NۍPЉM]XFPuUR E&x[t;9ufVuUR ;ENE+XSPUEGEЃVEEPUEEPE PEU U+ZSR뗃RIE BjEEPU E[UWVS } uЋt!ȩt-F\F@F8džt1ɉ!tFXF4t F<t FLt FP(t FT4tʉ%9t^du(%9tV`uxte[^1_Rjjj)PjS64n t멐SjjjjjP6n QjjjjjP6m Pjj%j PjR6mt e[^1_ÐRjjjjjP6m QjjjjjP6m RjjjjjP6um QjjjjjP6Ym RjjjjjP6=m USP]xu 1]ÍvQjjjjj3mǃx 1]USQɋEulp]Ív9lt<pljjHPRjQ3lǃdǃh ]9pu몉Ív]  ] L$ ] @; ] tÉuvUWVS(ƋD$DՋ|$@T$R)Ѕۉ!ȃ  v'([^_]Ív$ɸ't (D$$99V)ꋞ T$)щș҉D$ T$'t)9ݺ'xD$ @$$|$ 9D$t)99xD$$ 9L$$v9~0)9} #C9D$$\\$$D$$([^_]ËC;D$~);D$v|$  9C9~ )99t)ȋ9dC9kT$$\\$$c(@ɸ'  \$$(BT$$T$$D$$۸'\$$D$$C9~D$t)9~9b|$ ,9~(D$t)9~D$$7C9D$t܉)D$)@y @D$$;T$Y)9W \$$L$$D$$UWVSH6FF XZhAH6EF$[XhDH6EtF N Y F(hGH6EF0XZhJH6EF,\  F hMH6EF[XhPH6E \ ɉF FhSH6JEFhXZhVH6eEF`[ hYH6HEFd FLFPFTFXdžh\H6EF\h_H6DFL. hbH6DFPt heH6DFTt hhH6DFXt \ t Fd\ F4F8hkH6Q hnH6C F4F<F@hqH6P+ htH6CuF( FDwHFDhyH6xCFHY[h|H6gCFlXZhH6VCFpY[hH6qCXZhH61CY[hH6ICXZhH65CY[hH6!CXZhH6 CY[hH6BFtXZhH6BFxY[hH6BF|XZhH6B[XhH6BuhH6aBu=  dždždždždždždždždždždžhH6AhH6AhH6At džHPjjjjj6UdžHhH6A4Pjjjjj6ThH6GA jjjjj6ThH6AdžY[hH6MhH6MhH6@hH6@XZhH6b@tdždž\ udždžSjjjjj6Sjjjjj6ShH6 @ jjjjj6aShH6? jjjjj6,SdžHhH6?BhH6O?džQjjjjj6RjjjjjhH6/?[Z P6RjjjjjhH6?ZYP6hRjjjjjhH6>Y[P69R jjjjjhH6>[Z$P6 R(jjjjjhH6s>ZY,P6Q0jjjjjhH6D>Y[4P6Q8jjjjjhH6>[Z<P6}Q@jjjjjhH6=ZYDP6NQHjjjjjhH6=Y[LP6QD ҉Pu4,u$uudžTuu:u džX= vdžTdžXV '\ u F dž\dž`dždž|dždždždžhp vvVe[^ÐhH6<$hH4~Xt*XJ4<t4$] VdP$4,Dh`\hآ  0hآ jGjh\e[1^ÍvFP8x[FhFdHF`HldžHFDFV5VtuF|tFxUG= džT7`W (hH61:vhI6:FdhH69F<F@hqH6FhI69h I69Fu]Ӎ}uD+EA9u}}\le[^_Ív} } $ pEHUM][E]EEE}tUM4 EH9(9Љt G9t]94tUM]9U҉UMEH;EwMuPu uu jjjuj]3): U+t"QjjjujM19 KuPjjjujE09UR UMS]M E)؉UP2EE\EPR)MQ)؃ U PUȉˍ2`PRj) Vj E C\C)P& VjUE BB`)P&][]UEJ9t$ӐU 9t) MIM]@K9uO}EEH;EE 9EUM]9t}9t G9t]94tUM]9 ىUĉUMM…ɉUUEH;EE]uPu uuq}U\uxt1>PjjjujM17jjjujE07C ;]uUURU:vE);E EUM]9t]]PE)PEE U\EEčERP 'MQ)؃ PU `UčUPR&] SuUE BEċ\P& Su]E C`EčP&CEUEJ9ӋU 9t) MIM]@K9unE1ɋu};M܍uE@EEHA;MuURU)‰UERjjjVjP]35 ǂxQjjjujP25 nRjjjujP]31r5 ;]t C;]uE@E- RMIMEe.UWVSEHEtjU] ]ҋ1K uijuE9UJ9U;u# VUE uju+}$]}QjjjujE00 Ouۉ+]+]uRVP\Euu֍PRU EPڃ SE]`P4V& Eu CluPFURj \EPFU Rj`EPp-U܉UE;Mu^xu/EPtu @|VujuPM,_Qjjjujuvx6%/K uPE)PjuwMA|O_u)PjjjVjEpt0K. uMAxu]Ctu C|o+EWPju}U}Ot%+]QjjjSjMqx1O9. uPuju}8UB|)}PjjjujMqt1- Oue]K9EPtu x| Q1ҋE uju}IMA|}Qjjjuj]st3b- Ouu+uRVj]M|P Vju#+uQVj]U|P VjMS3u Q1ҋEڿ jju#}]}QjjjjjE0y, OuPECPj\E CPj` uj| uj^RjjjWWPE0, VjjjWWP]3+ SjjjuuP]3+ HRjjjuuPU2RjjjuuPE0RjjjWWPE0PVPj)Ӌ\P VЃ PjF)‹`P Wj|F)P WjF)P UZxUBtE@tEXx^HEQjjjWWPU2MRjjjuuP]3`* 'uVxN8UZtMMr\US ]jS蚺$趼CE1ҋ]US]SC HPjS C HPjSCu]ÐQjjjjjP3) ]ÐUSQ]C u \ uCu$]]RjjjjjP39) RjjjjjP3!)] ]US ]] jS蜹$踻Y1sC HPjS;Cui5 3^'X\NX`NXNXNXNXN]]NvRjjjjjP3I( |UWVSE]EU EۉUEZ9RUR9‰UA+U9~)9,ETE+E9UڋM9ʉUUE|E E@E)؋UD;Et)ڋET)؋TTDDI9Mu‹M9Mt&E|vA9Muu+u9}WSEp}EP9uuSVWu5D C  ;]|M$u;]})jj uSVWu5D C ;]|ًE0e[^_ÉEE;EE+EċU)EUtu(jCC1tfPhjR9%=@IC0F9su lv vl9rlPWVs]ǍV{C0<vP;PDCB/C@DC0F9sGC0F9s7tP;PtDCB*Rj*1҅tPRC4(Qsob vQj/빍v 4%C< P<USp$%Xs(%Xs Xs%Xs %YsCu S'<]Ív P< S<]ÍvUWVS \ u} ]K<9CE C uEeEC1҅Rsjjh&CV 1ɅtHQ4C1҅tPRs:&CXu$jhIjj&C FQPh#Jhآ 萜|0ch|0=] D0PuPpPjjpE0D0Fph`@h5hآ j1jh\ h<h jp1Dž`Zp s h6J艚1ۃtC PPVjj@;CDC/C؉j 1h;JtCPSj1hEJtCPSà j1hWJtCPS\ Ez hlJҙEU1Zuuu pe[^_Ã"VQۛXZ`SWǃJ҉xLF@FtP tK tޅtG9| 9_PPSW=SljӋJ҉y VYu;`t |\`U[SW)p4$p`9PhD VĚ 9tZS :\"< ȃPppL*pJBǃd@dd:X@D Dd:N`UKFHx`F@F ti tڅt G9|9_CPPSWSljDw` V蜘9tYS v|\VKe)<J0Dw$.BtvE 8t(Pw$W U B_E )ރzu9 GʼnU e[^_ËE ؍CՃGw\$/=] VPRQA h,SPBe[^_ÍE 9E fj%w$W XZAM JBM 9*t0AM 9wU 3vjw$W G)ƃ9~e[^_Ã_~7*Ӌ)ÃP[w$W )E 8tE Pw$W - ~Yc~(0CdcPw$W 0C Pw$W 0tM @M 1qM Ѓ)‰M hM Ayp/*"%9M M 2`r`M BJM gfffӉș)Ӎ)ʋ*E zlsTH,+t^-)v] ÐUU VSҋ]s 't3C LPu uuuuRS] s ]  e[^ÍvUSS] ] ҈t,J;Jt$D] B] @] ]ÐQP1tBP5]  ] ]ÐUWVS U ]1ҋs {tE C C'j I  uuuuju S] s {]  e[^_U @] tÉ@] h\jXZh\jYXjjXZjj ÉU @] uÉ@] jjXZjj{YXjjpXZjj e<] Ð] ÐUjÉUh(j] $ÍvUWVS<5(] u4 (]  $] Ȣ h j 8] t e[^_Ív 8] 5$] DXZh 5(] 袌$]W  =0] E%e?EEEVShT5(] H$$%1҃9 u,]  1Ҹ5   ]  @tѸ@B1=  u   5 , ] e[^_ÃhtJhvJ見(] u]hآ jjhJ臌$車e? /  P1 ShJhvJ+$] tUvT] ÐUSd] tN Ov= %P5] 5 ] 5$] $] =Ĉ tN=Ȉ tE]  Et Z RjEP5Ĉ |Ȉ ] ] u}=Ĉ sPjj5L] Ќ j h 5L] ˌPjj5L] 蠌 5 h 5L]  ] Ȉ 1]ÐCE )jMEEY[hj]$T] $XZjS* jSj- EPEPj+ 5] 5 ] 5$] ш$%T] u"] S迋$T] t ]S蟋 jSj貋Pjj5(] m$U jhD] 5(] P$HHt.Pjj5(] 2$QjEP2] Pjj5L] ̉USP8] u]Ð] 8] ] Ph hT5(] 談$s] ]ÐUvUSP] t.]  ]  ] @C; ] u uӐX[UVS]u EPhhT5$] $j@t EEe[^ÐUWVS}58] hJĆt71t0@t j0u e[^_Ðe[^_lJt jWhJSS jhآ j5jh]肇 jSS։ҐUS EPЉȈ ] 臉H] t u蠇EĈ ]à u腇]? Pj h 5P]   jh uHu3RjS5(]  腅$tE 똃 jU=Ĉ t@j 5H]  j貈y = t 5Ĉ 贆ÍvUSP8] hآ j5jhT]YXjj艈u=Ĉ t ]]ÍvߐUSP4] H]4] t9 jy = tCuXC ]E * Ĉ 5L] X5P] ׅ] t D] 뇃 sC E])U j薄;T tT Xw ] <] t)v <] j\)<] uڡ] un=Ĉ ]  Ȉ ] BNP HQ5 h p$(# j(<=Ĉ {] QjhD] 5(] ς$Dž(<] ]  jW'D] Pj h 5L] w tK~KPRh 5L] x  Ȉ ] BtVȈ Åʡ<] ]  j롃 P<] =d j1ÍvU jj5\ 藄$ ] UWVSjhJ4ËE$%$-$5xx1t 1۸ 1vtCu1e[^_à tj 0P}/4] =Ĉ EF EFEFE FEP]E E$IF u+_u" ] U\ Y[hj@˃|uuM 1؁XZjhvJ jhqtPz1v SC螁 ujx覀K5 1Gu PHt1DžptTJ1<=> v:4BJ<=u쀺JtptJ@pGu;pEtpVhJhSSu hJhSSb$ $ h hTj讁 tuu u hJjP]S1уIQSĵ$Ђ j~PjFPu_u [uYue[^_àJ<=ptGAp EP豁EL] EP] ptJApSj|Pu1 ~| RPh 5P]  jh u 5  hh E0 uQhh U2l {  Pj h 5P] pXUWVS ]uۋu h] u:GtcCQPV`ҋE uPVqGe[^_Ívߍv_uCQjV`ҋE tPV6Ge[^_jP RS@0׿jp j@0w륉ST$@L$ \$u h] u!CD$Z`ۉu1D$ T$[v\$ȋJ`tD$ T$[AD$ T$[vUSEp 6Ã] !=]  S莗 SB$uǃ SRuPhh@ S@ <{tƃ GmC@ 3F;F D0F0*F2 s K s %PhJjPMQ]z1ҊEi< tBDM LBDߋC@hF;F\D0F0AFX phJC ph KjPEPy1҃E< tBDM LBDߋC2j hK1tFPVƃGCjhKˋS4}F;FqD0F0OFCDghF;F\D0F0WF } /F;F D0F0XFRC@ Fj h%K s s s %Ph0KjPMQcx1ҊEo< tBDM LBDߋC P(D@ @Ph4KjPMQx1҃E<< tBDE DBDEURDJHEɉTtBDžd;T^t@ATdE@Dd9PHttC @љPhFKjPEP>u1ҊEtN< tBDM LBDC@ uKKPPC@KKPV EPPUR= URPMQ$tDF;FtH t}e[^_nFtxtL wHtD VX39$GL<$e[^1_Éue[^_5Et Vc juWGLX6LUSSE]U tytYuQjjSa]]]ÉUSPE]U tytYu0X t ]]PjjSa]]]UUxH t EvBuH txt!jjjyRÐxuۉUuPjjjhj$h]2= ÍvUUxH t Ps1JUUxH t EGvBuH txt!jjjyRÐxuۉU uPjjjh8j$h]2= ÍvUWVS uEFtxtd VgmuCֻtP V jWuƋEpL_61҃e[^_Ée[^_DjjjyVxUSEB4XLrnHtCxtjSƒЋ]Ív S7؉UWVS Ep4E^1v SS B49t+ pLi SS B49u;Uuue[^1_UWVS  Z ;Z t}CHx(usLE9FuFxu P谋YXu v 裋Sx.F@9~ )F9|GxF@9} )‹F9| ;Z ue[^_RF$Pv$C0QF$Pv$C0跭뻉UVSjjEpjjjh Pp ju VyFL$V"e[^US jh 6} ҉@@ uD} uV C      } 1]É@ PRy} tCPRgy똉U5}  tX5} s1ÍvUSS   5}  } sY5} sC } uaC} t@0} SP C}       u`1]Ð@0} 떍v uUSP } t} t B9At2vd tEtt} t B9At,1]ËA9B~ɡ} tA$9B$~]ËB9A~΋} tA$9B$} QcuY5} r} XZh} 5} wY5} Yr} XZh} Sw$:r]ÐUWVSut$t$'wZp EtZvEp$VYXVWtXZuW腊$wYXWVpYZPS蛤$wXZj SU4$蹆M } u Vq<$|q$tqEe[^_ÉUWVSEEE} Eut$t6Ep$S9YXSVTsXZuV%YXVS4$ Ouà Spue[^_pUWVS(EEE EEEEEus$}sEEp$V詇XZVWrY[uW}XZ_ WV街 uSV蜦4$者M}u VKp}e[^_9pUWVS} urƃOt~Ep$V E9F 8 VCzt% tŃ t+N(uԃ V7E9F ~ȃ t Vք뒃 Voe[^ _à Voe[^ _ÉUWVS(EU EUEUUEu+rXEpr$rEEWuXq<$ UB @9GuG(|w Ur$SEp$C(:9s }VuUr$SWu^ZYPS艡^XUG+BPS{uUK(B$Uɍ4ti9s || SGw Sw Wx@ S0n<$(nEEe[^_nv So~9s }UB$RuEPS Svs S& Sނgvj SY$wI S}v W}svUS ]h} s rC P$} P$V1]U5} 'mdW t } u u1à Pl1USQdW ҋ]t 1]Ív jt} K B9AtL 5} l} X5} l} dW ]]A;Bt0} ;Bu RJl} dW P5} RWnX5} ljUS]jt} K B9A} uB} tK A9BdW h^K3]]1 5} k} Y5} xk} }dW XZh^K3}]]I;JM} ;HD Rk} Y5} k}  dW XZhqK3 1]ËB9AdW }Kh} RoY5} j} XZh} s oC P$} P$뜃h} QoC P$} ؉U} t1Ð u1ÉUS ]h} s aoC P$} P$1]U} ҋMtA9Bt ÉRq l1ÐUS]s y$BYs ~$i$XZC p$P蛀1]ÐU} ҋMtA9Bt ÉRq k1ÐUVS} ҋutF9Bte[^É Rk4$XZSv 6k$he[1^ÉUSQ} ҋMtA9Bt2} tA9Bt ]ÉI B9AtRQY B9CtÃRSj1]ÐUVS juB} ^4u3P} p$@} +B@PR} uj1e[^á} X$QS} @+B@PRP} p$} @+B@PRXZS5} ~} X$} t V눐5} 5} ahK6TvUVS uV4$#$#} tw^4} X$QS} @+B@PRP} p$} @+B@PRXZS5} }} X$} u,e[1^Ív5} 5} ؍} tԃ V{e[1^Ív V1P} p$} @+B@PR끐UWVS(uj } Ah} } ^ B9CtXZ+YRQ訉ZYPv ј_X5} 5}  } tI Ve[^1_ÉC;B;A|hK6e[^_à V 4$;XZS5} Ml럍v} P@$+Q+Y$zRPWQEF P(@ EP} p$W5}  } EV A$9B$E}\ VkN4EtF )X$uSuv =Xu e } t/ VR} ;P|;QE뉐 V4$3XZ} zGPRNz} @$^_P5} N{} X$} X$j PtF uv { j uv $F P( t@ PWv pP+t F ؃hKUWVSj}q} uT} } X+ZPR^ZPw F }  W(P1e[^_É } A} +BpA$+Z$QPVRE } p$V5} EG4t!QG P(@ PVw auSuw 3Xuc} t WyQ W<$G} r_XFPRbx} @$Y^P5} by} X$} X$ W<$XZS5} iPor G (hK7UWVS E}u t j7} uNj} } @+BPVRӧ1ۃ}  V؃e[^_ÍvEP} p$} @+B@PRjË@ pVsi u~ S}a} uY VxEe[^_É`f 7} Q W>v W뙉`f 7E^ V^XhK7vUWVS]s ste[^_à s bÉ$b$rǃ SSot4 S p$r9}؃ Ssuȃ St SoS(C C$} um} C0}  Vtt V_r9} VruС} uEF(tLF F$5} F0} e[^_I P,_녃 Soe P _뭃 Vgo릉UWVS} 5} aơ} @9F}^v Vnu} t^ Vgu1 Vh;EuHC9u Vs} @9F| Vh^e[^_à Vd u V>^e[^1_ÐUWVS} 5} `} Éu8\ Sn$fu Sp9|= Sr} @9C| S]e[^_Ë@pxσ S]e[^1_ÐUWVS 5} ]t.} t } tA9Be[^1_É } } B9AC @q9R99 Q_Y5} _{L JCPE} @9F}5 Vl4$e Vq} @9F|˃ V\<$}\e[^1_É SA9BA$9B$ R_ƃ} p$V;s sL} CPB$PVB4$&qt } @9F~ V[gVW^XZsLWoO(t+G EWV sLEEPV֑ WkNjCPCHUWVS} ۋ}t} 1e[^_É}  } A9BG @R9oI9d9\wPwLW 5} ]Y5} ]L EBGPE衄} @9C}5 Sj$wc So} @9C|˃ SnZXueZ } A9BA9BA$9B$ R\$\E} p$Vq_P} N(X$tS9^ }\ V,d t؃ t9GLt΃ VY_uYQv WK; Vi럃 Vnt} @9FW5} V[} p$VYpXZVur[YGP} B$[Pu7pXZuVD4$0nt } @9F~ VX[uXSu[XZwLulUB(%r uS wL+uVSЎwPwL 5} A[$E6[Xuoh} @U9B}0 uat6 uGm} @U9B|Ѓ u X4$XuV(Z9^ }$ V.bF(_Pu V0h׃Vu~뀃h]7< ugEp GPGHUWVS E}u t}  j" } A$} +Z$]SPA+B@PRE4$褒ơ F H(P  XG4C uuV5} 4XZh} 5} [} } @$ۉB$ VV1e[^_Ív EVá u2Sw &4$_ s(tJC C$Ee[^_`f 7/$gVE4$h_ s(u S>fG @ 륍vXG4u졄} p$S} @+B@PY_P5} } E B$PSRZCPRXk_X} @$EP5} Wl} P$U} ]X$ PeF 0hK7-`f 74$FUZUWVSE1t} t }   jo EP]K$yKU_@0qп/K uIIXu@I K[ u%I=}  } A$} +z$SPA+B@PR[^huEJƋ@ H(P (XCE@4uܡ} p$} @+B@PR} B$ P} @+B@PSZYP5} uWV5} XZh} 5} zX} } @$ۉB$ }  VoS uG$I$IXu K} UZ C(C C$1e[^_Ð } J];K9H@9B 5} "US5} ^yXZhu蓉Y_PS SR=}  u SCbUB @ $ u} Qp$@} +B@PR7vX uem5} SS$bXZ5} SxpE<E]XE[E'@E}4E{vE8EUSS]S Jɸt RQYXC p$PY1]USS]C@ S @9Bt# RbWXZC p$PHY1]Éɸt RVXZj s wYs KL뷐UVS]C p$sPDXZVs XC p$e[1^ÐUVS]SCBK Hq$PQWYXVs XC p$e[1^ÐUWVS uFU @19E׉}1 vPC9u vJQ1ۃv v mPC;]u v !QXZF p$PXytWF$VRPA0we[^_Åt lj}mMuF 9PZURF @EDUWVS }GPR OHR9ʋ] E}{G +pEt{1 wmUC;]u1 w UUC9uG p$P2WytuG$WRPA0xe[^_É)9|މ]9~{@ƉEpUM@4HLA @t!̉ x(A9PjjQ1҉Ívj)PPjQ)RϐUSPM@4HLA@ Q @9Bt!̉ x(A9PjjQ1ۃ؋]ÉSj)PPjQ)RύvUSP]@4XLCPҸt(SJC ;Pt S\PjjS21]UVS]@4XLCHʋ@S@ ;P$C ;Ht SPjjS1e[^UWVS}uu V^}fE fEm]m]t u 胬 uWF@ @9؋=`W }XCPv S^ C(tAC C$`W =`W e[^1_ÃP6e[^_Ð SMF @ 뮡 uǃhKU5D jjjjjh7h} hKE0 0ÍvUWVS} uWup]}fE fEm]m]t WQ t!PE0߿e[^_ÍvC5`W PEp SUZ S(t%C C$`W ?5`W e[^1_à SLUB @ ǡ nhKU2eU5D jjjjjh 9h} hKE00ÍvUWVS} uWu4\}fE fEm]m]t W t!PE0裾e[^_Ív5`W SEp WJUZ K(t%C C$`W 5`W e[^1_à SyKUB @ ǡ qhLU2hU5D jjjjjh\:h} h.LE00ÍvUVS uv @u- v R=É$DXZSv a$a:1҃e[^ÍvUWVS }@Hx(t w G w @ w LËG P(L p  GP9މE9|i w <^w GJt2O4t t S6GBvSw ` Sd91ҍe[^_Ð w Fu w <1ۉƃ,CVw K`Xw F;] w I u_H뿉 PGIG L p vGHGP9މE}O@ w J;É$HXZw S_$Y8 wL+uVw {n1 SA S V8UWVSEp :UNjB<$EXZSVVuP WB WEZYPVVu݋EP B9GtfWR^<$71e[^_ÃSVVu(v WA WSEY[PVVu뚃 WA댃 W47랐UWVS}w 9Yw EGËGXZSVVt_v w GY[PVVuCt w AMW A9BtmuR]Yu61e[^_ÃSVVt w G[ZPVVt w F[ZPVVut Q@6뚐UVS uv 8$%JËV @9Bt!SR/]$5e[1^Ív S5ue[^*UVS uv 8$EV ËB9Ct!RS\$5e[1^Ív S{5[XjV!e[^ÍvUVS ]s %8Xs ^E4$^JS F9BtVRR\4$51e[^à V 5Uj Ep j1ÉUVS]1 SDt SD$GtF uҍe[^à t]e[^oGvUWVS|uF} ED @t E Phx gE @^ CVF$+B| EES:GtB9X }:j v iXv %>F x(^8uՃ P$DF 9X |ƋD ZFHBu v 'iF H(ɋ^! x v =V4)߃0FDtEV B(^<9Z ~2u ubujvhv8v <EV B(yB C$x9~EFJX9F9EN$)ً@ME]} } X A\`ȋM~ E]Eg } ɉM} ۉ]NE9Huuu uW]REPuM ve[^1_ËV B(Z$;Z LPj r$Rg8FxSu ]SRR$E u v gF H(ɋ^ PA F x v q;V4)߃ v 9}  V@F4us^lZF X$  NH)j VKue[^1_à R@V s^@t v *CËF H(;X _ v 2$1E@t' v BËF P(;X FP1ۅ~ vLv eXv C:9^P^ C(CC C$W/ R?V R?V Fu ]SXZSFs v 8_^ {$VH:Eљ})WS#Ft4V z$/F P(tX 9 PD?F X " v 7tV B(u R?V 9z }FlPj Wv dV 뀃 P>F 8 S>F @ NT v %A;EP v ; Wf8ZYE Puċ]S@} 6u v c[v +8뷃 P5>F R6Ftz]|UbPj 9K} u8F @U;Bg;C^ER VqV ZE;X],E;X EX$B(t$9Z  EX$B(t19Z N둃 RF=V 9Z { } Mƒ R#=F 9X UWVS E]}u PhILVt VY[uuV1ۃ}tPWC<u_ S(tC C$e[^1_à SPv Z%^ K(tC C$1e[^É Sc3F @ RhLh,h XZh 6붃 QUU BЃ MwjjRQ=PjjjhRjhL1 UWVS E}] t w %ơ} tSv V2tV9u@tOVw @$_ C(t]C C$V!e[^1_Ív V#,t9u뮃hL74$!e[^_à S1G @ 뒃 SٻщUE =U} wjjPRÍvPjjjhSjhM2 UE =U} wjjPRÍvPjjjhSjhM2j USQE] tSh q$!XZEh 01]ÉU5D jjjjjhlUjhME0<0ÉUWVS E}u t19^tPWCuu V脎e[^1_ÍvUUBjjhAjjhUjh2M20UWVS u} t;  t-vVspu C9~EC u֍e[^_ÉuEtUCUWVS Uҋ} tY  tKE4v+EC t.usuC99~։{ uӐe[^_UVuSt3  t%VsuC C uݍe[^ÉUVuSt3  t%VsPuCC  uݍe[^ÉUSS    thvS Ps 苌Ys肌Љ Љ CЉ ډXЉ     u   ]UWVS8pEx $Em EE>uu^ux1UBYU[+BPRgEURE싘UEE1E!PSSuU܊:<.tjhЉ ,ËEЃCU؋ECC SjhMMjj}܃C1tU܋BPu܋C1҅tPRsC C      AVS Q1ۅҋt$ tvBH@)tBL9pt9Qut[^ÃzxQtBH@)t BxZL9QUVS]} vSzXt/VhPMh,h XZh 3(e[1^QhcMUSS]C} Ct/PhPMh,h VXZh 3М1]ÉQhcMh,h 'XZh 3衜1]ÍvUWVS = }ƣ G@Pv urvw `W `W /XZ p5} Ʊ`W _ s(t_C C$ p71҃e[^_jjPvۉY[PWZuԡ @ xL5 V S(G @ 됃huM7聛둉UWVS @= }ƣ G@Pv uuvw `W `W -XZ p5} ڡ詰`W _ C(tbC C$ p7Κ1҃e[^_ÍvjjPv軈Y[PW: uѡ @ xL5 S S'G @ 덃huM7aUWVS uVB} Mt8uM,tQhMQhMh,h  YXh 6X FP t xtqjhMjj蝆 SX PX 1҅StPR5X p jX hM1҅tPR5X LX e[^_jhMjj, SX 誄PX 1҅StPR5X  j!h^X 덉 PWvB tztkt ShMSh^jhMjj衅 SX PX 1҅StPR5X t j hMX ScUE t_EuPPh^h,h  XZEh 0B h 蝃Ph jjX  ÐPh _Qh@_US]@0JX@0LJ1]ÉUj蓙UU PUPU@ PUSp$蛙]ÍvUWVS E Unu}UNyt9Yt4PuWjhaj3hl_6 1҅"e[^_Ív^<jC pwsZG?^Cnwsm8S(Љ@9aHu@PwjV#UUE} ue[^_h_6AEEE} ue[^_዆ P^`f 6UU랋 P詥^ǃ1m Fp蔗^C C s^ w$2C^qPEt UiXEtEUWVSË@p$u } tuWjyS0e[^_Ð@t8t܃ hMH} &P CpP蹿P5} hMhVVYXjCpTXRPTjlPVPxhQh h@ T~PVh@ P39tȃ TbZPVu C@$ T2uWj PCphMMUSSU yE]Mt:Yt5nt@Nt;RQSjhG@tPVgt4jVtE PduSjWT e[^_ÐXRPVj<u G@9E> uډae[^_É P{|Ov~>SuSjWxōvUVSu5D jjjjj PhdjhMhtgh} h `6n0taF@u1tQe[^ÉPs @D^XCp s s N(tF F$ VC @ F$멍e[^UVS} ҋ]t } u]e[^A9BuA+B~ޡ} tA(tcq B(tC;r ~5D jjhdjhMh\h} hH`3l0e[^à R} ;p 몃 Q} p } 넍vUWVS E y]UEYntDNt?PRujhij'hp`3 1҅ u]zt uSMEC xUvu 3Sx{ juVzFLY0aZuy}EuUe[^_Ívt uNE ECxXP tq=X tt S|6E`f 3}EvZ P詝I@낃 Su @ XL u bvUWVS] }uSMtAH uu]E n}e[^_u]E }e[^_u]E yĐUUBxt1É@ thM2ΌU5D jjhdjhMhkh} h`E0C0ÐUuu jnuÐU5D jjhdjhMhlh} h`E00ÐUWVS E}Et u 9KE EGxEuc Wx juSwCLX7{|Xu v}twEu upEe[^_ÐE`f 7l}xElvH t5X t< WyAvt P넋P뾍v W?u @ xL u ?U5D jjhdjhMh@mh} h`E0?0ÐUWVS ]E; ƋC9tfVtHxFtD Sw jVWuGL^0zEe[^1_ÍvFxu SxƋC9u̐UWVS ]E;ƋC9tfVtHxFtD Sjv jVWtGLY0UzEe[^1_ÍvFxu SwLƋC9u̐U5D jjhdjhMhh} haE00ÐUVSUҋuE ]tDu-F @ pE ue[^雍e[^ÍvUVSuFH t~ut@t } t{5D jjjjh`pPhdjhMhtgh} h `60tF@um1uvjV91e[^j jjjh`pPFpBsPFpjjtPV밃Ps c;^XCp s s N(t F F$_ VC @ F$EUSPE y]UtYtnt#NtCxtAt1]ÍvtPjjS$É]ÉH tuPRujhqj$h@a39 ]UjjjuHÍvUWVSEMU tyt YuKYCECPjjQ rECtFH@)tFL9Xt69ru1e[^_GEtI~L WEr juV_qFLlj4$vE䉇 69r럋~L WEr jWhNDZYPV qFLlj4$jvEt Ps딐US ]j3iCxt%P t t,jjjyS]Ëtщ]]jZPjjjhrj$hha3j ]ÐUWVS(]P0rLx\U @\E4rEX3 EEEt uB= EujFx V4q juuoZEXL3u^E쉃uot~u uzEe[^_Ð`f 3 = mFxEfvX u HQ VYr@t P蕓Ee[^_ÍvUuFaUSP>DÃ1tCPScjSjjhuhptSE0虫01҅tЋ]à S`UWVS E uy}YntqNtlF@uMPhahS7 uWjhPvSn PS6 1҅e[^_ËF@ v VsLF;GP t֋uuWjVƒe[^_ÐVBt8uR5D uWhdjhMhtgh} h `6莻01҅e[^_G OuWPmPFpjjsnPV`uE]t UQw jV1҃ WGU}ME UuUEE NMtJÍvUWVS ]C3ǐH t t? S6u"^LC9uPjjS1e[^_Íe[^_j jWjh@xPjSHƉ1] UWVS}w V V [ZPËG8u݃ HC VN(F E V  V[ZPËGܬu݃ C V N(F U)‹G8G<9‰Uu VÉ$R XZVS]#$)G<G8ЋUU1ۃ9t.Uvj V1G<G8C+E9uۍv V1҅tNe[^_à V V U V 2 V뮃 V 렃j V!14$땍v  \t}>tx|ts:tn*ti/td,t_.tZ?tU;tP]tK}tF=tA+t<-t7_t2)t-&t(^t#%t$t#t@t!t 1҃~túUVS P$  V5u V.t t1 te[^Íe[^ÐUVS P$X  s Su Se[^ÍvUVS PƉ$ V74$uv Vsu- VW YZPCuσ V ^ Ve[^ÍvUWVS]S~ EIEv S3uh } t} t@9C~M Sh$( ljƉ;u&;uu!;}} St e[^_à S e[^_à S$u˃ S ^UWVSuV u e[^_Ðu} t} t @9F}ЍvEǐ V? t} t} t@9F}É;]v9nt^UVSu v Ãu? S'V B9Cu_ Sxum Stƒ SQu} t} t@9C~ S{SR`$ e[1^à S e[^UVSu v 9 Sc$KV B9CuV Sud S t Stك S $V B9CtSR$]e[1^à SHe[^ÐUWVSE EE]EEECE+E9C ~L S_ZPC:u+ SuK(u S/E9C  S_s(AE9C  S\ƃv V#uJ VZYPNjC蠥u̓ V.?! SmC+F)EY_SV74$XZj S*CE]$.EtTuS+1}ыEDEC)EEE ]e[^_}j S:*EM}uC)EEE ]e[^_H SC9FE V{vUWVS(Ep E$E=t ue[^1_à uWUB URH)щMZYuP_Mq ^Ep D uV$UB @9F V.ÉEZYPSY _XC+FPV=E$+4$#MA8;E~EEp uUEBM苀XZEp uXUrƃ VM9NM V aPF迢t VuiSu(XuMA(Uz<*9y kSUB^ VK V V_XSF E9F V[_PuC'YuEP(MҋY<m9X suMqhuu VZ\j u&_u%^u[uOve[^1_à ucE9x j Ur &[Mq !< EV$N.?! W/SF辠E9Ftd V4$F uM9N% V4$tU9VuكuMq 8ÃuUr "놃 VE܅tMAhj uc%XuOVW<$MA<$pZYPUBSEuEp v V  VuEp u_U9Z }uUr -j uw$Xu  u{ËEEEZYPSCUY_+BPRDvUS]jC{tC P} ;P} ]](} ;P @,S貄}  SK$} C R9Pۡ} } @,} u1]à SyUjh 螯Ð  @    B ÍvUSSt, p[Ys[XZSh 謯$r]UE ÍvUWVS ֋] ENUXNjB @GFS1҅utPRv\96F5 tFp Mq EP BG } } B҉t MA9Bt1 RuXEp =P0ǃ G3ZFpPjj2\F$CjSu-t-W t$]  ] ] @; ] tOFGF7~8= 5 e[^_Pjjjv$5} jj#Mà Q *TUWVSZ C$WCC$Pv뫃 j C ss$C p]Xs Ys$ ZARs$Y C$sPC$P# Ws$v_ j C ss$C pXs TYs$YhvUWVS E UEB @E} uU} ~UE^9t#C t CV9t C H} uXUC$ B ps$rpXu F<u^XLJu,W uPVSutuu肽XZVu+t@U9B[w juC)P3PG P/  u1@W avUBPMAR 3FU܋BPM܋AR 3W Fjh H|MQ R@PP QPQ  Avuu>XZVut@M9Aw juC)P3PG P UBM+APw4)UMGB+A PwQ<^Xuu蟻[u^YuUEsvGuWG:tEHaEXcvPVSuavUB@0E܋@@ SUB @ P3PG P誢 {MԋAU؃+BPw'MԋU؉GA +BPwRXZuu^XuXuE uXu+tEHWMA @.Ee[^_ËxPEp 1tEEHUB @G=GB1҅tPRMq EX C(C C$OG1҅tPRMq G:} tEX s(cC C$_h} Mq Ȼ} K(|C C$h} 5} 蛻XGZ1҅tPR5} )} C(C C$LJuWjutE1EgE@G1҅tPRUr MY C(tbC C$NG1҅tPRMq 耼hdbE0PMq h SUB @ 늃 SUB @ 4LPUr 먃 Sl} @ SS} @ nh} Ep } s(t]C C$h} Ur GY1҅[tPR5} } S(H S} _ S} @ 됃 SUB @ vUVS} ۋutvF @} tF9Bt. RXv 谶P0ǃPj+ZYPV^e[^Íe[^]UVSơ~ Mt } xX SjQjRjjj; V à BRP0XZFjSh(hh h$h} hN6o01҅the[^ÉPHue[^ v F X$F 9XtjV5ƒe[^à P&ك S ։UEj1ÐUEjÉUEj1ÐUWVS E}] EG u@NnYy Rtcrt^bBEt EVWV$K1҃e[^_ÉuFEEu }e[^_@~t΃VW땉 PuVhhj1hb7w 1҅Zu }e[^_UWVS EEu} ] F 1Ʉ}t8‰ƒ0Cw!$3FҍDBЉFA ũ SFuEEu }e[^_AF  uAF uAdž iAF  TAF ?nGuVh(hh hh} hN7ql0e[^_F 1U EU PuPu US]ǃ5ǃ]ÍvUS]ǃǃ]]霔UWVS(Ep 衱NjUXr 1葱1ۋO;ut6U < tt<tr<tn<.FC;]u҅ `<$X ZtCH@)tsLM9N9Zue[^_ÐtN띃WB<$袾YXW j]  ] ] @; ] DW:RVP,F 9HX PS~ G(tG  9ZG$1 W軽F @ UWVS ËE֋}tCu] s M s t9PshXWCVP tA@S1e[^_Ívhb3/<$ ̓ W XZhN3/ݍvUWVSh Oş j WPWjjI ۉS;SDB CjhOjjt7V;Vt/DB FjjjPEe[^_ÐP1QtCPVjjjPEVe[^_ÍvP1QtCPS~ƃ^hbE0.OUWVS} j jhOjj7 ۉS;SDB CjhOjjt]V;VtUDBF tXP;PtPDB_;_t6Duu ju\ $ GǍe[^_Ãuu ju* $ P1tGPWǃ j ]UWVS 5  E1ɉ@~ tP9} 9~ 9puAuыEFFPjSv萍~0N49ωEV  )9E~p9P} ))PEpvV0F49}gF )ЉFE@*;V}xKx AEӋ7e[^_PhEpv1E;F~랋F 뙋V 9U]jvkF j JF6UWVS uE1ɉ@~ tP9}xt 9puAu͋EFFPjSv~0N49ωEV  )9E~X9P} ))PEpv V0F49}OF )ЉFE@(x QEӋGPhEpvE;F~붋F 뱋V 9Uujv F, jHF e[^_ÍvUWVSE U %E E%4@~ UtM9N 6u$~ ,~ ;؋  h: h %F ~ ,~ ҉UH 9g) ;(~  ENEV$~ BN+E }E$~ }u+M 4}9~F V V>@~ @~ tF u FC6uAKuS@~ @~ F u ~6Ƌ$~ EUF %}MV9y@~ FF 4@~ APjuMqˆE}W9vB+UPRvwG+M )RjF+EPEFe[^_PhvEpkPhjvNjjq݈UBL j@(~ NE ~  ) (~  P[E ~ (~  PUWPjN(~ <$ g= ~ }K(~ Pu*E ~ 'AKPjhOjm$衆Uj8 P  @@@ @@0@4@,@@ @$    ÐUWVS uV,t+  ~ H V t+  ~ H Ft V P诊Xv^FF BV5 1$~ @~ @~ t9rt/ыuGu҉$~ e[^_à VGwӋ뻃 POovVS\$ S0C49}Hs )։L$K t.C,+   ~ P9~)Ѹ)ȉC4[^Ðs 뺍vC4[^ÊT$D$ 8¹wIÍvUS]C P@@]ÐD$t D$ÍvT$1tB:u)‰ÐUSPUҋ] t49Z|Ћ]ÐÃC PBPAPZЋ]à STƒUWVSMEɋ} EtIu7Q;YUE;]~Eu2Y9 U@9u;}(e[^_ËEESQ3몉+EPj WQqe[^_ÉUSRUҋ] tB9|9~+ZЋ]ÉCPR‹@9})Sj rR ƒЋ]ÍvUWVS ]tHu u;s{F9~U ;Mڈ s9} @QuuU Pe[^_ËE U14VS:Ã멍vE )Pj WSuQuuU ÍPe[^_UWVS Mɋ}tA] ;Yq<9~U 1ʈ:Y9u 6U ]B9ue[^_ËE 18SQ볋E )Pj VQ봐UE1҅tPRPjj_ÉUVSUEҋ] Et s;rB9|+tWEe[^ÍsVR‹B9}Չ)Qj rRFŠDEre[^ÊDM re[^ÍvWVSVt$T$D$T$t\tX1@t@tI 9Љt&D$8s؍ 9Љuډ[[^_É[[^1_[[^_ÉUWVS\$ۋl$t$|$ t=t'9)1 8w7u+B9u9|1[^_]ÍvK[^_][^_][^_]ÍvUE 1҅MtPRP1tAPQdÍvUWVS1;] }ut/UPVW 9}M8wtvC;] uҍe[^_Íe[^_ÍvUWVS1;] }ut,UPVWY 9tM8wuC;] uՍe[^_VSD$ H 9Y4tP49tFӋ9u[^ÍvUS]sjC|CP sjCCP]ÍvS\$CH4;K4t[É9 ‹@9H4u9u[ɋ@$u'B(u BH+HJ,Mb)ȉÍvVSP$X S+SƉȉә[N,^ÍvUWVSRuU~X9t V49P4Ut e[^_ÉÉU9tE9C4te[^_ÍvUVSPË@(Yu9ts49r4uJ(tȋ9ue[^ÐvS\$H4;K4t[Ív9 ‹9H4u9u[ÍvUWVSuVVE9[Xto  E.VPQBFB9u0rFt#N9qu9FEYu߉E  N9qt=VPQBFB5 0 rFEe[^_EFEe[^_ËD$P9‹9txyÍvUS]jSPSP\ @@ P ]ÐS A1҅t$|B9Qu[ÉUWVS  Zۋ}utCxKLt CH@ u9Zue[^_Ð VWu usLЋ  9ZUWVS  Zۋ}utCxCLt CH@$u9Zue[^_Ð VWu usLЋ  9ZUWVS }1u j` ËE$UC\ECBHCTC$UCE CXE CCC C s8CHCLCTCPS0B4C4{(tV)U u6ECDtHE£ S X؍e[^_à PWN$k CDEuEPt-BCB  Z뮉[4C(QU[ ZZ 뉃 S 1xUWVSƃ UV9rEFB9p0t9p4t9Bt+9p8u9p0@8uxtUEV뿉~8u}9r 95 FBFH@ 5 t VLEF\t vDR4$ 4$6;Ee[^_ÉÉV9r fF0t3B 95 \] EFBF8uƋB ƒ RЋUF\PEUWVSEXw UE@rzE)ECC 9uSy9ZE~>)E7C +E]C ~GU9Z t4E)ƋEx9tcC@49C4uO{0ECtU9Z C uEÉUC C UC C ~덃XUr vUr9؉EuuuUrKUB[Cs99]tIPx @x9~7HɉEx PxƋ9tHxPx9vvFx-Vx&)PWv vpF PvE09uŋUEx9Cs{LtCHP@u1s{UszC CC$9ue[^_Rs ssLЃ뾋}9]]tJPx @x9}8HɉEx PxE܋9tHxߋPx9|vsx-Cx&)PPs saC PsU2荺;]uŋEUzC&QVs sL҃CHPs jU|P~ s jECP_sUWVS }GX9Xt1K0up+p)ƍVC8G9XuωE [^_AUWVS }O1҉ːC09uw+wә9t6C0u9})ƒmC8O9uː} [^_UVSuNQ9tDxt>Ë@(tA9t S(t9u9Yt {t{&e[^É9tF@4Ee[^0VBSJ v#e[1^ÍvUVSuNQ9t\xtVV~=ËA9tX{(t9u9YtGJcSBX v1ۃe[^Ív9tF@4Ee[^ՐUSP]C P9¹t zS t 1ɉȋ]ÍvRCSFݐUSR]C 9¹t zS t 1ɉȋ]à SUSQMPQXQ)ЃYCA…x/YڐBAHB9u Q]AȉUWVS EH49ptU] t0Ee[^_ÐȍU ] uVN9Zt V?Ee[^_1ːCx C09utʋF+F9tC0u9})ƒeC8NɐUWVSu蛿KA19})ʍrjuVWjS| e[^_ÍvUVS]C0CTuLCPt% 1҃{"CsPrCPe[^ÐCu h] uкɋS SJP6CT떉T$D$PTËT$D$PPST$@HHt[[ÐST$@HHt[[ÐUEpUEp-UE0ÍvUE0,ÍvUVSuBX+XR9Zt 6te[1^Ë pe[1^ÍvUE@0K1ËD$;D$vD$ÐD$;D$~D$ÐD$;D$}D$ÐD$;D$~D$ÐUWVS }u ]PSVWqy = te[^_ÍvUWVS }u ]RSVWry = te[^_ÍvUurÐUu urÉUu urÉsvUS(j ]jS jSE uEr]ËL$< t< uBv< t< t;D$tUWVSERD P} uPu!HRD PPt CGNuCRD PPuE1ҍe[^_ÍvS\$L$ t< t< t< t< t<#t BAu␉1[ÍvUVSU ut :u(BCuD RPPu e[^Ät܍e[^ST$ \$ t :u3BAut< t< t<#t< t < t [É 1[ÉtѸS\$:D$ uB1ɉ[ÐUVSuB< v -u- SnU <-t0< w C0< v1e[^ÍvVSt$ :"\$L$u;Btt<"t<\t0IBCuvt<"t?<\t/Bu<"t0[^Àztʃ~\BCBC룐zt˃븐B[1^ÉVSSt$ ɸt \t3B:-tًD$D$1Y[^ÊBtB<\t!B؊BtB j@BcBBuhPuT$L$AÍvL?ȀA ?ȀA?ȀAЃ?ȀAAÍv?ȀA?ȀA ?ȀA?ȀAЃ?ȀAAÉЃ?ȀAAÉ ?ȀAЃ?ȀAAÉ ?ȀA?ȀAЃ?ȀAAÉWVS\$s T$t>ʉ%C@CCV? ȅ҉S Ct[^_ʉ%=tc%=%=tc%=%=CC [^_ÐCC KhCC KރCC KƃCC KC [^_ÃCC KCC [^_ÐD$@@ ÐUWVS,}WU1YPWZXZCUue[^_ÐUWVS,E0E EPYtPEP KFXZx吋E E0e[^_UShQsY SYÃj.SM[tSj8^$1<^$TY [XhQj^$1^$-YP $dD t < ]Ð h Q;D  < ]à hQX0 hQX QUS ] uuKt]E ]8]E ?]%Uu RPu?t‰1Ð1Ð1Ð1WVS19ƉӋL$'9D|!|9t}x9}[^_Ív94~H9UD S@] t MuЋ]Ã~tCv⍃d0vÁtvvjz4&Z1@u~2_~%)#t*#t=OvwP?0tHBQ C4%i FT=+v=v?v`v y=h=\RUE jV &@ZUE jk@  @YUE h_ @ZÐD$_tÉT$BЃ v _tÉUE j @YUE j z@ZUE j ^@YUE h ?@ZÐUE h` @YÐUE h@ @ZÐUE j @YUE j @ZUWVS E awE e[^_ËE ~H t25L H E tƒYE tǡP E e[^_à hXH $ X H 1ۃP 3@݀ 9t6݀ Q݄ F)ЉCt$uȋ݀ ͍v݄ )9uAӉ5L 2UWVS E AwE e[^_ËE ~=T t25X T E pƒ^E tǡ\ E e[^_à hhWT $ W1ۃ=T E\ 0SVVZYt x C:u0ۋV0v\34t!PjqPVtD34V0Cuf1V034t!Pj+PVt34Cuġ` 5` e[^ÉUWVS,U 1Dž#Dž hR_uM1D@=uVu hPNP'Y^PPS8ttS%SVu hPDžMN u L؃e[^_ÃPiXZPP-SuADžP_XPPs<fUYQPh1SPxKXZP_XPP; Ph1SP4KT@wJÉUWVSS}<-u uG<-t-uF-ttCvtEE9Eu-GF<-uG<-t-uljF-tu.tt Y[^_Y[^1_UWVS }1` 7` 1ۅÅtWs/ZY}u h4S*Jt. WPh9ShSXKhMSS:JƃtNVWCtwe[^_ÍvW4` ZYC` uݡ` M WhOShaShSJhMSSIx 1V W3(ZYuڍ O h M` @oS@@(@,@ H@@@@@ @$` Ze[^_Ë @ F H J M U V A C M M 114:GN557799q~-0226799XY`24RSrs   "'(229;  * . ` c j o *0/000 #gis No errorNew FileError reading fileError seeking fileError opening fileError writing fileFile on disk is newer %lo%lx%ldHOME-r+rawDEADJOE *** File '%s' *** File '(Unnamed)' %5ld abortabortbufargaskuargbacksdelchbacksmenubackwdelwbeepbegin_markingbkndbkwdcfwrdcblkcpyblkdelblkmoveblksavebofbofmenubolbolmenubopeopbosbufedbuildbytecancelcenterctrlcolcompletecopycrawllcrawlrdelboldeleoldellindnarwuparwdnarwmenuuparwmenudnslideupslidedropdupwediteofeofmenueoleolmenuexecmdexplodeexsaveffirstfiltfinishfnextformatfmtblkgomarkgrowwshrinkwisrchkilljoekillprochelphomehnexthprevinscinsflindentrindentlineloselowerltarwrtarwltarwmenurtarwmenumacrosmarkbmarkkmarklmathmodemsgnbufpbufnedgepedgenextposprevposnextwprevwnextwordprevwordnmarknotmodnxterrprverropenparserrpgdnpguppgdnmenupgupmenupicokillplaypshpopqreplqueryquerysavequotequote8recordredoundoretyperfirstrunrsrchrtnsavescratchselectsetmarkshellsplitwstatstopswapswitchtabmenutagtoggle_markingtomarkbtomarkbktomarkktomatchtostw0tw1txttypeupperyankyappyankpopRead onlyNo such commandcmdcmd: rProcessing '%s'...done type0123456789ABCDEFplaygomarksetmarkrecorduarg ^K %c Macro %dPlay--Repeat %s%dRepeatLINES%dCOLUMNSBAUD%uDOPADDINGNOXONJOETERMHOME/.rc/opt/sfw/etc/joe/Couldn't open '%s' %ld %s Unknown option '%s' menu/%s/joe.tmp.XXXXXXTEMP/tmp/.promptquerysrqueryaqueryoverwriteOvertype modeInsert modeT Overtype autoindentAutoindent enabledAutindent disabledI Autoindent wordwrapWordwrap enabledWordwrap disabledWord wrap tabTab width (%d): D Tab width lmarginLeft margin (%d): Left margin rmarginRight margin (%d): Right margin squareRectangle modeText-stream modeX Rectangle mode icaseIgnore case by defaultCase sensitive by default Case insensitivity wrapSearch wrapsSearch doesn't wrap Search wraps menu_explorerMenu explorer mode Simple completion Menu explorer autoswapAutoswap ^KB and ^KK Autoswap off Autoswap mode indentc Indent char istep Indent step french french spacing highlightHighlighting enabledHighlighting disabledHighlighting spaces no tabs midCenter on scroll guess_crlf Auto detect CR-LF guess_indent Guess indent crlfCR-LF is line terminatorLF is line terminatorZ CR-LF (MS-DOS) linumsLine numbers enabledLine numbers disabledN Line numbers markingAnchored block marking onAnchored block marking offMarking asis Meta chars as-is forceForce last NL nobackupsBackup files will not be madeBackup files will be made Disable backups lightoffAuto unmark exask Exit ask beepWarning bell enabledWarning bell disabledBeeps nostaTop-most status line disabledTop-most status line enabled Disable status line keepupStatus line updated once/sec Fast status line pg No. PgUp/PgDn lines csmodeContinued search rdonlyRead onlyFull editingO Read only smarthomeSmart home key enabledSmart home key disabled Smart home key indentfirstSmart home goes home first To indent first smartbacksSmart backspace key enabledSmart backspace key disabled Smart backspace purifyIndentation clean up enabledIndentation clean up disabled Clean up indents picturePicture drawing mode enabledPicture drawing mode disabledPicture mode backpathBackup files stored in (%s): Path to backup files syntaxSelect syntax (^C to abort): Y SyntaxencodingEncoding nonoticenoxonorphanhelpdopaddinglinesbaudcolumnsskiptopnotiteusetabsassume_colormain\i%n %m %M %S Ctrl-K H for helplmsgrmsgkeymapmnewmoldmsnew%dmsoldValue out of range/opt/sfw/etc/joe/syntax*.jsfHOME%s/.joe/syntaxCharacter set not found%s%dONOFF%s%srProcessing '%s'... done %s %d: Bad key sequence '%s'defdone %s %d: Unknown option %sinheritinclude %s %d: Invalid context namedelete %s %d: Couldn't open %slicohzoseohcxnamclcdutABAFmembmdmhmrsgxsuguc_msdadbcsrrsfsrSFSRaldlALDLnsinbcbs doupndittabtxtholl crncRILEUPDOchcvcVcmcele[3%p1%dm[4%p1%dmSfueusxrpt SbtetiulsesotwdcDCdmedimeiicICipmi<%X>inverseunderlineboldblinkdimwhitecyanmagentablueyellowgreenredblackbg_whitebg_cyanbg_magentabg_bluebg_yellowbg_greenbg_redbg_black/.*Couldn't read directory TERMCAPTERMPATH :.idxr%x%s is out of date HOME.termcap /opt/sfw/etc/joe/termcap /etc/termcapTERMpcr/dev/ttyCouldn't open /dev/tty wSHELL/bin/sh-c/dev/ptmxTERM=ptemldtermCouldn't execute shell '%s' main(%s)%2.2X(Macro %d recording...)%-4lX(Read only)*SHELL*(Modified)%3d%-3ld%-4ld%2.2d%3ldUnnamed 100 Selection started.Selection cleared.No blockRead onlyJOE_FILENAME=-c/bin/shUnnamedInvalid line numberGo to line (^C to abort): Invalid column numberGo to column (^C to abort): Invalid byte numberGo to byte (^C to abort): %xASCII 0%c%c-ASCII 0%c--ASCII 0x%c-ASCII %c%c-ASCII %c--ASCII 0x--ASCII 0---Meta-Ctrl-Meta-QuoteMark %d setSet mark (0-9):Mark %d not setGoto bookmark (0-9):Not foundFwrd to char: Bkwd to char: Msg (^C to abort): Insert (^C to abort): %ld\i%ld messages foundNo messages foundNo more errors(Unnamed)File %s savedFile %s not savedFile saved. not saved.SIMPLE_BACKUP_SUFFIX%s/%s%s%s%s~NamesCan't replace modified fileI-find: Float point exception%lfMissing )toplineslinecolbyteheightwidthExtra junk after end of expr%Gmath=Modified flag clearedNo block%dRead onlyWrappedNot foundFind (^C to abort): Replace with (^C to abort): No ptys availableSHELL-i/bin/sh-cRunProgram to run: Build command: Kill program (y,n,^C)?rtagsNot found:%ldInvalid line numberCouldn't open tags fileTag search: vfile: out of memory HOME%s %d: Unknown class %s %d: Missing state name %s %d: Unknown character %s/.joe/syntax/%s.jsfr/opt/sfw/etc/joe/%ssyntax/%s.jsf*buffer%s %d: Class already defined %s %d: Bad string holdrecolorstringsistringsdone%s %d: Missing string %s %d: Unknown option %s %d: Missing jump %s %d: No state noeatLC_ALLasciiLC_CTYPELANGcasciiposix8859-1iso-8859-18859-2iso-8859-28859-3iso-8859-38859-4iso-8859-48859-5iso-8859-58859-6iso-8859-68859-7iso-8859-78859-8iso-8859-88859-9iso-8859-98859-10iso-8859-108859-11iso-8859-118859-13iso-8859-138859-14iso-8859-148859-15iso-8859-158859-16iso-8859-16ansilatin1latin2latin3latin4cyrillicarabicgreekhebrewlatin5turkishlatin6nordicthailatin7latin8latin9koi-8koi8-rkoi8-tkoi8-ucp1251cp1256cp1255armscii-8tis-620georgian-psCHARMAPEND%xHOME%s/.joe/charmaps/%sr/opt/sfw/etc/joe/%scharmaps/%sutf-8%s/.joe/charmaps/opt/sfw/etc/joe/charmaps*.. *** Modified files in JOE when it aborted on %s*** JOE was aborted by signal %d *** JOE was aborted because the terminal closed ** Line %ld Col %ld Offset %ld(0x%lx) %s %d(0%o/0x%X) Width %d **** Line %ld Col %ld Offset %ld(0x%lx) ** Help file '%s' is not properly ended with } on new line. Do you want to accept incomplete help screen (y/n)?Macro to record (0-9 or ^C to abort): No. times to repeat next command (^C to abort): There were errors in '%s'. Use it anyway?\i** Joe's Own Editor v3.1 ** (%s) ** Copyright © 2004 **\iCouldn't load termcap/terminfo entry \i** Joe's Own Editor v3.1 ** (%s) ** Copyright (C) 2004 **\iIndent char %d (SPACE=32, TAB=9, ^C to abort): Indent step %d (^C to abort): One space after periods for paragraph reformatTwo spaces after periods for paragraph reformatInserting spaces when tab key is hitInserting tabs when tab key is hitCursor will be recentered on scrollsCursor will not be recentered on scrollAutomatically detect MS-DOS filesDo not automatically detect MS-DOS filesAutomatically detect indentationDo not automatically detect indentationCharacters above 127 shown as-isCharacters above 127 shown in inverseLast line forced to have NL when file savedLast line not forced to have NLHighlighting turned off after block operationsHighlighting not turned off after block operationsPrompt for filename in save & exit commandDon't prompt for filename in save & exit commandStatus line updated constantlyLines to keep for PgUp/PgDn or -1 for 1/2 window (%d): Start search after a search repeats previous searchStart search always starts a new searchSmart home goes to indent firstSelect file character set (^C to abort): Syntax definition file not found%s encoding assumed for this file %s %d: Unknown command in macro %s %d: No context selected for macro to key-sequence binding %s %d: End of joerc file occured before end of help text %s %d: macro missing from :def %s %d: command name missing from :def %s %d: context name missing from :inherit %s %d: :include missing file name %s %d: No context selected for :inherit %s %d: No context selected for :deletecm=%d ch=%d cv=%d ho=%d lf=%d DO=%d ll=%d up=%d UP=%d cr=%d Sorry, your terminal can't do absolute cursor positioning. It's broken Couldn't load termcap entry. Using ansi default You are at the command shell. Type 'exit' to return You have suspended the program. Type 'fg' to return Lose changes to this file (y,n,^C)? Selected lines not properly indentedCommand to filter file through (^C to abort): Command to filter block through (^C to abort): Unicode (ISO-10646) character in hex (^C to abort): Ctrl- (or 0-9 for dec. ascii, x for hex, or o for octal) not changed so no update needed.File %s not changed so no update neededAll modified files have been saved.Some files have not been saved.No modified files, so no updates needed.Could not make backup file. Save anyway (y,n,^C)? Couldn't make backup file... file not savedFile exists. Overwrite (y,n,^C)? File on disk is newer. Overwrite (y,n,^C)? Name of file to save (^C to abort): Name of file to write (^C to abort): Load original file from disk (y,n,^C)? Name of file to edit (^C to abort): Name of buffer to edit (^C to abort): Name of scratch buffer to edit (^C to abort): Name of file to insert (^C to abort): Save changes to this file (y,n,^C)? Lose changes to this file (y,n,^C)? File %s has been modified. Save it (y,n,^C)? Left side of = is not an l-valuecase (S)ensitive (R)eplace (B)ackwards Bloc(K) NNN (^C to abort): (I)gnore (R)eplace (B)ackwards Bloc(K) NNN (^C to abort): Not found (search restricted to marked block)Replace (Y)es (N)o (R)est (B)ackup (^C to abort)?Program already running in this window"SHELL" environment variable not defined or exportedEnter build command (for example, 'make'): %s %d: Missing color for state definition %s %d: Missing value for option ?z9D: 3J:P:Z:d: 7l:t: y:~:l:$+::+:9@9:t::p::C&:x:::A9T9: S:::: y:; ;P*;;p;;C(D;+J;P;TZ;d; k;q; w;t };\; O;U;n;;1;;,;;;;.;; ;X;\;;Q6:;T\;o;;1;; 6;<L <; p6; <<<<L ;,;;;;-;;];!<|%<L)</<5<x?<TNE<OL< S<pX<]<hd<,;C$;k<o<J;,D;Z;P;u<y<hh~<n< <R<`a::<<d<P < <m<4P;<<<( <C< <CT <C <(2< D4<|<=DV=d9X<̛S<J: 3D:Z:pP: =C$)l: H7d:==@ =C> p|w w w w w j>T-020AX22q>9|;:y>9|;:>8|;:>L >>>>X >>>>\ >?!?,?` 0?A?@N?P V?i??v?T ~???} ????} ??@&@~ +@8@L@\@\ j@}@@@d @@@@d HV@@h xV@@ A VVA&A 0AEA[AiA V WpA{A`W DWlWAADW WWAA@W WXAA AABBx B0BFBVBdW ^BxBBBhW 0XTXBB?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?:co#80:li#25:am::ho=\E[H:cm=\E[%i%d;%dH:cV=\E[%i%dH::up=\E[A:UP=\E[%dA:DO=\E[%dB:nd=\E[C:RI=\E[%dC:LE=\E[%dD::cd=\E[J:ce=\E[K:cl=\E[H\E[J::so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m::mb=\E[5m:md=\E[1m:mh=\E[2m:me=\E[m::ku=\E[A:kd=\E[B:kl=\E[D:kr=\E[C::al=\E[L:AL=\E[%dL:dl=\E[M:DL=\E[%dM::ic=\E[@:IC=\E[%d@:dc=\E[P:DC=\E[%dP:2Kn,X   `  %KKJH0xPAT    Љ Љ      ` `     @ @ Search    @    _ _ 0009AFaf ~ "3PO`otuzz~~1VY_a  !:@U` ,0J   9 < M P T X p       ( * 0 2 3 5 6 8 9 < < > B G H K M Y \ ^ ^ f t       ( * 0 2 3 6 9 < C G H K M V W \ ] _ a f p       ( * 3 5 9 > D F H J M U V ` a f o       ( * 9 > C F H J M W W ` a f o :?[GIjq!#')*,269@YY_FHHJMPVXXZ]` FHZa|v  6@S`lnprs w EHMPWYY[[]]_} ' * R W W _ c j q t !:!=!K!S!!!#$&$@$J$`$$%&&&&}&&&''' ' ''')'K'M'M'O'R'V'V'X'^'a'''''''''*....////0?0A00001,11111112 2C2Q2{222223v3{33334MNƤ-0j68<>>@ACDF?P #0FIRTfhkptv #0J%(M&*TV  9;>@DFFJPR֦ !~ "3PO`otuzz~~1VY_a  !:@U` ,0J   9 < M P T X p       ( * 0 2 3 5 6 8 9 < < > B G H K M Y \ ^ ^ f t       ( * 0 2 3 6 9 < C G H K M V W \ ] _ a f p       ( * 3 5 9 > D F H J M U V ` a f o       ( * 9 > C F H J M W W ` a f o :?[GIjq!#')*,269@YY_FHHJMPVXXZ]` FHZa|v  6@S`lnprs w EHMPWYY[[]]_}  ' * R W W ` c j q t !:!=!K!S!!!#$&$@$J$`$$%&&&&}&&&''' ' ''')'K'M'M'O'R'V'V'X'^'a'''''''''*....////0?0A00001,11111112 2C2Q2{222223v3{33334MNƤ-0j68<>>@ACDF?P #0FIRTfhkptv #0J%(M&*TV  9;>@DFFJPR֦ !/:@[`{~DFO`otu~~Z_  KUjmpp 0J  < < > M Q T b e p p   < < > B G H K M p q   < < > C G H K M V W p p   > D F H J M U V   > C F H J M W W //??FFOOZ[*?q,269JOVYahr|mn26RSrs  ' * R W W ` c j p t ~ !!!!! !!!!!!#!%!%!'!'!.!.!2!2!:!:!@!D!J!K!S!_!!#$&$@$J$`$$$$%&&&&}&&&''' ' ''')'K'M'M'O'R'V'V'X'^'a'''''''''*....////000 0*0006070=0?00000001122 2C2Q2{222223v3{3333Ƥ))>? #0DIRTfhk ;@[e #&*55OOoo ( ( ) )    ( ( ) ) _ _ 0009AZ__az "3PEEzz1VYYa!:@J`inoq, 9 = = P P X a f o       ( * 0 2 2 3 3 5 5 6 6 8 8 9 9 Y \ ^ ^ f o r t       ( * 0 2 2 3 3 6 9 = = \ \ ] ] _ a f o     ( * 3 5 9 ` a f o     ( * 9 ` a f o .0:@EGNPY )@GIj!#'))**@IPUY_FHHJMPVXXZ]` FHZiqlov  1@Q`lnp w EHMPWYY[[]]_}q q   !!!! !!!!!!$!$!&!&!(!-!/!1!3!9!=!?!E!I!`!!$$00!0)0105080<0A000000001,111111114MN-0j(*68<>>@@AACCDDFOP=Pptv!:AZf0J%(MTV  9;>@DFFJPR46NPnp֦AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./0i2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~STVWY[`cihoru      "#$%&'()*+,-./0123PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z()*+,-./0 1 2 3 4 56789:;<=>?@ABCDEFG H!I"J#K$L%MaAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZx     ! #"%$'&)(+*-,/.1I325476:9<;>=@?BADCFEHGKJMLONQPSRUTWVYX[Z]\_^a`cbedgfihkjmlonqpsrutwvzy|{~}S      #"%$'&)(+*-,/.1032STVWY[`chioruE0123456789:;<=>?@ A!B"C#D$E%F&G'H(I)J*K+L,M-N.O/PQRSTUVWXY Z [ \ ] ^_a`cbedgfihkjmlonqpsrutwvyx{z}|~     a1b2c3d4e5f6g7h8i9j:k;l<m=n>o?p@qArBsCtDuEvFwGxHyIzJ{K|L}M~NOPQRSTUV     ! #"%$'&)(+*-,/.1032547698;:=<?>A@CBEDGFIHKJMLONQPSRUTWVYX[Z]\_^a`cbedgfihkjmlonqpsrutwvyx{z}|~`      (!)"*#+$,%-&.'/08192:3;4<5=6>7?@HAIBJCKDLEMQYS[U]W_`haibjckdlemfngopqrstuvwxyz{|}p!`!q!a!r!b!s!c!t!d!u!e!v!f!w!g!x!h!y!i!z!j!{!k!|!l!}!m!~!n!!o!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$A!B"C#D$E%F&G'H(I)J*K+L,M-N.O/P0Q1R2S3T4U5V6W7X8Y9Z:()*+,-./01 2 3 4 5 6789:;<=>?@ABCDEFGH I!J"K#L$M%az7:HKwz~#3SSTTVVWWYY[[``cchhiioorruuEE0_aa '07@EQW`gp}p!!$$AZ(MAZ69GJxy}2/`~1V~(/8?HMY_ho&!&!*!+!`!o!$$!:%QQ%QQ+Q2Q=QDQOQVQaQhQsQzQQQQQQQQQQQQQQQ RRR%R1R9RER2QJR2QQRDQXRVQ_RhQfRzQoRQvRQ|RQRQRQRQRQRQRQRRR%RQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~2Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~DQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~A=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqcVQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&$0^4{'%1_5|  l\  !m]hQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8V(;`"f}W)<a#gJ~K. *EL6rhj/ +FM7sikzQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO!QRSTUVWXYZ[\^_Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQRQ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0^1_Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~"*(6;`f}jJ#+)7<ag~ kK. ELhr/ FMis8Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[Q  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  V W. y"6*;`CELrAZj{}/ z#7+<aDFMsB[k|~ R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    x !@AVW`atjvukw%R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `a}~RSx9R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~A  `ayz{ B} ~ RSx|CPZpDQ[qR  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QS%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  & ! 0 9     "   "!: Q!N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%% %%%%%$%,%4%<%%%%%%%%% #%""H"d"e"!#P%Q%R%QTT%VWW%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%l%N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ S & ! 0 9   R    "   "!Y: Z\[_^VQ!TXUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOR  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ~  & ! 0 y9 R    "   "!: S  !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQR  R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   & ! 0 9     "   "!:   R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~)( .],-& \[^1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUVZR  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  & ! 0 `9 R    "   "!a: SxV @(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic January 2005GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)@(#)SunOS 5.10 Generic January 2005ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482.interp.hash.dynsym.dynstr.SUNW_version.rel.text.rel.got.rel.data.rel.bss.rel.plt.init.fini.rodata.rodata.str1.1.rodata.str1.4.rodata.cst8.dynamic.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab @ ((P2"xLxLoee0- Bee 7 Bee@ BeeJ BeeS Bee Whh1nn\P'P'bp'p'h'' p2x8x8-2SScc;c c  CJ hp \  { 8"X@   x " )` /5H =x6!BGh(!<QX nH __flsbuf__fsr_init_value__iob_Jv_RegisterClasses_environmainungetc__1cG__CrunMdo_exit_code6F_v____Argv__register_frame_info_bases_DYNAMICfputs__filbuf_mcountprintf__fsr_get_exit_frame_monitor_edataatexit_init__longdouble_used__deregister_frame_info_bases_lib_version_etext_finiftell_start_exit_end__fpstartstrchr_GLOBAL_OFFSET_TABLE__PROCEDURE_LINKAGE_TABLE___dso_handlelibc.so.1SYSVABI_1.3SUNWprivate_1.1libncurses.so.5/usr/sfw/lib:/opt/sfw/lib:/usr/local/lib7qN    (    !       "    5 % % h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hpjj t Rh` tt PEu TRU RP"}X PPURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUS[Rt :|ҋ|u鋃t tPƃ]ÐUS[ÿP$tSjPtPxt,t xP]UWVS,(Dž(J҉(x`,@F t t#uY(,@Ft tJ҉(y߃ h("Ã(у h(Ã똃 h h(Y_h(HS1ƅ(H(x2,@Ft8 t3 tֈ/G(H(y΃ h(hÃuȅ=\qƄ=1Dž ||t&::t<|t<:uፌ ؋Ƅ1Ivj tcAۈt :T+Ph|  Ze[^1_Ãj Zut8H8x9< <h89Dž:Oh8j "UVS[nhp@Ћu[^US[;g[US[[ %lx ^n~.> @  ` |  oopoxoo 8@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic January 2005@(#)SunOS 5.10 Generic January 2005GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath)@(#)SunOS 5.10 Generic January 2005ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482.interp.hash.dynsym.dynstr.SUNW_version.rel.text.rel.got.rel.data.rel.bss.rel.plt.init.fini.rodata.rodata.str1.1.dynamic.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab 4 `"||opp0- B 7 B@ BJ BS Bx WHH1HH\@ @ b` ` hx x p2| | ;  T  D8Nu9 yC070701001a706d000041ed0000181b0000000a000000034525399200000000000000550000000100000000000000000000000e00000000reloc/sfw/etc070701001a706e000041ed0000181b0000000a000000044525399200000000000000550000000100000000000000000000001200000000reloc/sfw/etc/joe070701001a706f000041ed0000181b0000000a000000024525399200000000000000550000000100000000000000000000001b00000000reloc/sfw/etc/joe/charmaps070701001a7070000081a40000181b0000000a00000001452452bb00002a75000000550000000100000000000000000000002300000000reloc/sfw/etc/joe/charmaps/klingon Klingon-ASCII % / % version: 1.0 % An 8-bit character set with Klingon characters in range 0xD0 - 0xFF and % KOI8-R (ASCII w/ line drawing) for the rest. CHARMAP /x00 NULL (NUL) /x01 START OF HEADING (SOH) /x02 START OF TEXT (STX) /x03 END OF TEXT (ETX) /x04 END OF TRANSMISSION (EOT) /x05 ENQUIRY (ENQ) /x06 ACKNOWLEDGE (ACK) /x07 BELL (BEL) /x08 BACKSPACE (BS) /x09 CHARACTER TABULATION (HT) /x0a LINE FEED (LF) /x0b LINE TABULATION (VT) /x0c FORM FEED (FF) /x0d CARRIAGE RETURN (CR) /x0e SHIFT OUT (SO) /x0f SHIFT IN (SI) /x10 DATALINK ESCAPE (DLE) /x11 DEVICE CONTROL ONE (DC1) /x12 DEVICE CONTROL TWO (DC2) /x13 DEVICE CONTROL THREE (DC3) /x14 DEVICE CONTROL FOUR (DC4) /x15 NEGATIVE ACKNOWLEDGE (NAK) /x16 SYNCHRONOUS IDLE (SYN) /x17 END OF TRANSMISSION BLOCK (ETB) /x18 CANCEL (CAN) /x19 END OF MEDIUM (EM) /x1a SUBSTITUTE (SUB) /x1b ESCAPE (ESC) /x1c FILE SEPARATOR (IS4) /x1d GROUP SEPARATOR (IS3) /x1e RECORD SEPARATOR (IS2) /x1f UNIT SEPARATOR (IS1) /x20 SPACE /x21 EXCLAMATION MARK /x22 QUOTATION MARK /x23 NUMBER SIGN /x24 DOLLAR SIGN /x25 PERCENT SIGN /x26 AMPERSAND /x27 APOSTROPHE /x28 LEFT PARENTHESIS /x29 RIGHT PARENTHESIS /x2a ASTERISK /x2b PLUS SIGN /x2c COMMA /x2d HYPHEN-MINUS /x2e FULL STOP /x2f SOLIDUS /x30 DIGIT ZERO /x31 DIGIT ONE /x32 DIGIT TWO /x33 DIGIT THREE /x34 DIGIT FOUR /x35 DIGIT FIVE /x36 DIGIT SIX /x37 DIGIT SEVEN /x38 DIGIT EIGHT /x39 DIGIT NINE /x3a COLON /x3b SEMICOLON /x3c LESS-THAN SIGN /x3d EQUALS SIGN /x3e GREATER-THAN SIGN /x3f QUESTION MARK /x40 COMMERCIAL AT /x41 LATIN CAPITAL LETTER A /x42 LATIN CAPITAL LETTER B /x43 LATIN CAPITAL LETTER C /x44 LATIN CAPITAL LETTER D /x45 LATIN CAPITAL LETTER E /x46 LATIN CAPITAL LETTER F /x47 LATIN CAPITAL LETTER G /x48 LATIN CAPITAL LETTER H /x49 LATIN CAPITAL LETTER I /x4a LATIN CAPITAL LETTER J /x4b LATIN CAPITAL LETTER K /x4c LATIN CAPITAL LETTER L /x4d LATIN CAPITAL LETTER M /x4e LATIN CAPITAL LETTER N /x4f LATIN CAPITAL LETTER O /x50 LATIN CAPITAL LETTER P /x51 LATIN CAPITAL LETTER Q /x52 LATIN CAPITAL LETTER R /x53 LATIN CAPITAL LETTER S /x54 LATIN CAPITAL LETTER T /x55 LATIN CAPITAL LETTER U /x56 LATIN CAPITAL LETTER V /x57 LATIN CAPITAL LETTER W /x58 LATIN CAPITAL LETTER X /x59 LATIN CAPITAL LETTER Y /x5a LATIN CAPITAL LETTER Z /x5b LEFT SQUARE BRACKET /x5c REVERSE SOLIDUS /x5d RIGHT SQUARE BRACKET /x5e CIRCUMFLEX ACCENT /x5f LOW LINE /x60 GRAVE ACCENT /x61 LATIN SMALL LETTER A /x62 LATIN SMALL LETTER B /x63 LATIN SMALL LETTER C /x64 LATIN SMALL LETTER D /x65 LATIN SMALL LETTER E /x66 LATIN SMALL LETTER F /x67 LATIN SMALL LETTER G /x68 LATIN SMALL LETTER H /x69 LATIN SMALL LETTER I /x6a LATIN SMALL LETTER J /x6b LATIN SMALL LETTER K /x6c LATIN SMALL LETTER L /x6d LATIN SMALL LETTER M /x6e LATIN SMALL LETTER N /x6f LATIN SMALL LETTER O /x70 LATIN SMALL LETTER P /x71 LATIN SMALL LETTER Q /x72 LATIN SMALL LETTER R /x73 LATIN SMALL LETTER S /x74 LATIN SMALL LETTER T /x75 LATIN SMALL LETTER U /x76 LATIN SMALL LETTER V /x77 LATIN SMALL LETTER W /x78 LATIN SMALL LETTER X /x79 LATIN SMALL LETTER Y /x7a LATIN SMALL LETTER Z /x7b LEFT CURLY BRACKET /x7c VERTICAL LINE /x7d RIGHT CURLY BRACKET /x7e TILDE /x7f DELETE (DEL) /x80 BOX DRAWINGS LIGHT HORIZONTAL /x81 BOX DRAWINGS LIGHT VERTICAL /x82 BOX DRAWINGS LIGHT DOWN AND RIGHT /x83 BOX DRAWINGS LIGHT DOWN AND LEFT /x84 BOX DRAWINGS LIGHT UP AND RIGHT /x85 BOX DRAWINGS LIGHT UP AND LEFT /x86 BOX DRAWINGS LIGHT VERTICAL AND RIGHT /x87 BOX DRAWINGS LIGHT VERTICAL AND LEFT /x88 BOX DRAWINGS LIGHT DOWN AND HORIZONTAL /x89 BOX DRAWINGS LIGHT UP AND HORIZONTAL /x8a BOX DRAWINGS LIGHT VERTICAL AND HORIZONTAL /x8b UPPER HALF BLOCK /x8c LOWER HALF BLOCK /x8d FULL BLOCK /x8e LEFT HALF BLOCK /x8f RIGHT HALF BLOCK /x90 LIGHT SHADE /x91 MEDIUM SHADE /x92 DARK SHADE /x93 TOP HALF INTEGRAL /x94 BLACK SQUARE /x95 BULLET OPERATOR /x96 SQUARE ROOT /x97 ALMOST EQUAL TO /x98 LESS-THAN OR EQUAL TO /x99 GREATER-THAN OR EQUAL TO /x9a NO-BREAK SPACE /x9b BOTTOM HALF INTEGRAL /x9c DEGREE SIGN /x9d SUPERSCRIPT TWO /x9e MIDDLE DOT /x9f DIVISION SIGN /xa0 BOX DRAWINGS DOUBLE HORIZONTAL /xa1 BOX DRAWINGS DOUBLE VERTICAL /xa2 BOX DRAWINGS DOWN SINGLE AND RIGHT DOUBLE /xa4 BOX DRAWINGS DOWN DOUBLE AND RIGHT SINGLE /xa5 BOX DRAWINGS DOUBLE DOWN AND RIGHT /xa6 BOX DRAWINGS DOWN SINGLE AND LEFT DOUBLE /xa7 BOX DRAWINGS DOWN DOUBLE AND LEFT SINGLE /xa8 BOX DRAWINGS DOUBLE DOWN AND LEFT /xa9 BOX DRAWINGS UP SINGLE AND RIGHT DOUBLE /xaa BOX DRAWINGS UP DOUBLE AND RIGHT SINGLE /xab BOX DRAWINGS DOUBLE UP AND RIGHT /xac BOX DRAWINGS UP SINGLE AND LEFT DOUBLE /xad BOX DRAWINGS UP DOUBLE AND LEFT SINGLE /xae BOX DRAWINGS DOUBLE UP AND LEFT /xaf BOX DRAWINGS VERTICAL SINGLE AND RIGHT DOUBLE /xb0 BOX DRAWINGS VERTICAL DOUBLE AND RIGHT SINGLE /xb1 BOX DRAWINGS DOUBLE VERTICAL AND RIGHT /xb2 BOX DRAWINGS VERTICAL SINGLE AND LEFT DOUBLE /xb4 BOX DRAWINGS VERTICAL DOUBLE AND LEFT SINGLE /xb5 BOX DRAWINGS DOUBLE VERTICAL AND LEFT /xb6 BOX DRAWINGS DOWN SINGLE AND HORIZONTAL DOUBLE /xb7 BOX DRAWINGS DOWN DOUBLE AND HORIZONTAL SINGLE /xb8 BOX DRAWINGS DOUBLE DOWN AND HORIZONTAL /xb9 BOX DRAWINGS UP SINGLE AND HORIZONTAL DOUBLE /xba BOX DRAWINGS UP DOUBLE AND HORIZONTAL SINGLE /xbb BOX DRAWINGS DOUBLE UP AND HORIZONTAL /xbc BOX DRAWINGS VERTICAL SINGLE AND HORIZONTAL DOUBLE /xbd BOX DRAWINGS VERTICAL DOUBLE AND HORIZONTAL SINGLE /xbe BOX DRAWINGS DOUBLE VERTICAL AND HORIZONTAL /xbf COPYRIGHT SIGN /xd0 Klingon letter A /xd1 Klingon letter B /xd2 Klingon letter CH /xd3 Klingon letter D /xd4 Klingon letter E /xd5 Klingon letter GH /xd6 Klingon letter H /xd7 Klingon letter I /xd8 Klingon letter J /xd9 Klingon letter L /xda Klingon letter M /xdb Klingon letter N /xdc Klingon letter NG /xdd Klingon letter O /xde Klingon letter P /xdf Klingon letter Q /xe0 Klingon letter QH /xe1 Klingon letter R /xe2 Klingon letter S /xe3 Klingon letter T /xe4 Klingon letter TLH /xe5 Klingon letter U /xe6 Klingon letter V /xe7 Klingon letter W /xe8 Klingon letter Y /xe9 Klingon letter glottal stop /xf0 Klingon digit 0 /xf1 Klingon digit 1 /xf2 Klingon digit 2 /xf3 Klingon digit 3 /xf4 Klingon digit 4 /xf5 Klingon digit 5 /xf6 Klingon digit 6 /xf7 Klingon digit 7 /xf8 Klingon digit 8 /xf9 Klingon digit 9 /xfd Klingon , /xfe Klingon full stop /xff Klingon mummification glyph END CHARMAP 070701001a7071000081a40000181b0000000a00000001452452bb000059ed000000550000000100000000000000000000001a00000000reloc/sfw/etc/joe/jmacsrc Initialization file for JOE Gnu-Emacs Joe JOE looks for this file in: 1 - $HOME/.jmacsrc 2 - ${prefix}/etc/jmacsrc This file can include other files by placing the following include command in the first column: :include filename FIRST SECTION: Default global options (these options can also be specified on the command line. Also the NOXON, LINES, COLUMNS, DOPADDING and BAUD options can be specified in environment variables): Put each option you want set in the first column: -option Sets the option --option Clears the option -mid Cursor is recentered when scrolling is necessary -marking Text between ^KB and cursor is highlighted -asis Characters 128 - 255 shown as-is -force Force final newline when files are saved -nobackups If you don't want backup files to be created -lightoff Turn off highlighting after block copy or move -exask ^KX always confirms file name -beep Beep on errors and when cursor goes past extremes -nosta Disable top-most status line -keepup %k and %c status line escape sequences updated frequently -pg 1 No. lines to keep for PgUp/PgDn -csmode ^KF after a pervious search does a ^L instead -backpath path Directory to store backup files -nonotice Disable copyright notice -noxon Attempt to turn off ^S/^Q processing -orphan Put extra files given on command line in orphaned buffers instead of in windows -dopadding Output pad characters (for when there is no tty handshaking) -lines nnn Set no. screen lines -baud 19200 Set baud rate for terminal optimizations -columns nnn Set no. screen columns -help Start with help on -skiptop nnn Don't use top nnn lines of the screen -notite Don't send terminal initialization and termination strings: prevents restoration of screen on exit. -usetabs Use tabs to help optimize screen update. -assume_color Assume terminal has ANSI color support even if termcap/terminfo entry says that it doesn't. This only applies if the terminal otherwise looks like an ANSI terminal (support bold and capability starts with ESC [). -guess_crlf Automatically detect MS-DOS files and set -crlf appropriately -guess_indent Guess indent character (tab or space). -menu_explorer Stay in menu system when a directory is selected (otherwise directory is added to path and menu is closed). -icase Search is case insensitive by default. -wrap Search wraps -autoswap Swap markb with markk when necessary Status line definition strings. -lmsg defines the left-justified string and -rmsg defines the right-justified string. The first character of -rmsg is the background fill character. The following escape sequences can be used in these string: %t 12 hour time %u 24 hour time %T O for overtype mode, I for insert mode %W W if wordwrap is enabled %I A if autoindent is enabled %X Rectangle mode indicator %n File name %m '(Modified)' if file has been changed %* '*' if file has been changed %R Read-only indicator %r Row (line) number %c Column number %o Byte offset into file %O Byte offset into file in hex %a Ascii value of character under cursor %A Ascii value of character under cursor in hex %k Entered prefix keys %p Percent of file cursor is at %l No. lines in file %S '*SHELL*' if there is a shell running in window %M Macro recording message %y Syntax The formatting escape sequences may also be given: \i Inverse \u Underline \b Bold \d Dim \f Blink -lmsg \i%k%T%W%I%X %* [%n] %y %M -rmsg %S Row %r Col %c %t Ctrl-X H for help SECOND SECTION: File name dependant local option settings: Each line with '*' in the first column indicates the modes which should be files which match the regular expression. If more than one regular expression matches the file name, than the last matching one is chosen. Here is a list of modes which can be set: -utf8 File is UTF-8 coded -syntax name Specify syntax (syntax file called 'name.jsf' will be loaded) -highlight Enable highlighting -smarthome Home key first moves cursor to beginning of line, then if hit again, to first non-blank character. -indentfirst Smart home goes to first non-blank character first, instead of going the beginning of line first. -smartbacks Backspace key deletes 'istep' number of 'indentc's if cursor is at first non-space character. -tab nnn Tab width -indentc nnn Indentation character (32 for space, 9 for tab) -istep nnn Number of indentation columns -spaces TAB inserts spaces instead of tabs. -purify Fix indentation if necessary for rindent, lindent and backs (for example if indentation uses a mix of tabs and spaces, and indentc is space, indentation will be converted to all spaces). -crlf File uses CR-LF at ends of lines -wordwrap Wordwrap -autoindent Auto indent -overwrite Overtype mode -picture Picture mode (right arrow can go past end of lines) -lmargin nnn Left margin -rmargin nnn Right margin -french One space after '.', '?' and '!' for wordwrap and paragraph reformat instead of two. Joe does not change the spacing you give, but sometimes it must put spacing in itself. This selects how much is inserted. -linums Enable line numbers on each line -rdonly File is read-only -keymap name Keymap to use if not 'main' -lmsg Status line definition strings- -rmsg see previous section for more info. -mnew macro Macro to execute when new files are loaded -mold macro Macro to execute when existing files are loaded -msnew macro Macro to execute when new files are saved -msold macro Macro to execute when existing files are saved -square Rectangular block mode Macros for the above options are in the same format as in the key binding section below- but without the key name strings. Default local options -highlight -istep 2 No '.' in file name? Assume it's a text file and we want wordwrap on. * -wordwrap File name with '.'? It's probably not a text file. *.* Diff * +--- -syntax diff * +*** -syntax diff * +\[1-9]\+\[0-9]\[cda] -syntax diff Text file. *.txt -wordwrap Assembly language *.asm -wordwrap -syntax asm *.s -wordwrap -syntax asm *.S -wordwrap -syntax asm Mason *.mas -autoindent -syntax mason -smarthome -smartbacks Perl * +#!\+\[ ]\+\[a-z/]/perl\> -autoindent -syntax perl -smarthome -smartbacks *.pl -autoindent -syntax perl -smarthome -smartbacks *.pm -autoindent -syntax perl -smarthome -smartbacks C language file *.c -autoindent -syntax c -smarthome -smartbacks -purify *.cpp -autoindent -syntax c -smarthome -smartbacks -purify *.c++ -autoindent -syntax c -smarthome -smartbacks -purify C language header file *.h -autoindent -syntax c -smarthome -smartbacks -purify *.hpp -autoindent -syntax c -smarthome -smartbacks -purify *.h++ -autoindent -syntax c -smarthome -smartbacks -purify Verilog file *.v -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify Verilog header file *.vh -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify VHDL file *.vhd -autoindent -syntax vhdl -istep 2 -smarthome -smartbacks -purify XML *.xml -wordwrap -autoindent -syntax xml HTML *.htm -wordwrap -autoindent -syntax html *.html -wordwrap -autoindent -syntax html JAVA *.java -autoindent -syntax java -smarthome -smartbacks -purify Hypertext preprocessor file *.php -autoindent -syntax php -smarthome -smartbacks -purify Python * +#!\+\[ ]\+\[a-z/]/python\> -autoindent -syntax python -smarthome -smartbacks -purify *.py -autoindent -syntax python -smarthome -smartbacks -purify CSH * +#!\+\[ ]\+\[a-z/]/csh\> -autoindent -syntax csh *.cshrc -autoindent -syntax csh *.login -autoindent -syntax csh *.logout -autoindent -syntax csh *.csh -autoindent -syntax csh TCSH * +#!\+\[ ]\+\[a-z/]/tcsh\> -autoindent -syntax csh *.tcsh -autoindent -syntax csh *.tcshrc -autoindent -syntax csh Shell * +#!\+\[ ]\+\[a-z/]/sh\> -autoindent -syntax sh *.sh -autoindent -syntax sh *profile -autoindent -syntax sh BASH Shell * +#!\+\[ ]\+\[a-z/]/bash\> -autoindent -syntax sh *.bash -autoindent -syntax sh *.bash_login -autoindent -syntax sh *.bash_logout -autoindent -syntax sh KSH * +#!\+\[ ]\+\[a-z/]/ksh\> -autoindent -syntax sh *.ksh -autoindent -syntax sh LISP *.lisp -autoindent -syntax lisp *.lsp -autoindent -syntax lisp *.el -autoindent -syntax lisp Makefile *akefile -autoindent -syntax conf *AKEFILE -autoindent -syntax conf Pascal *.p -autoindent -syntax pascal -smarthome -smartbacks -purify *.pas -autoindent -syntax pascal -smarthome -smartbacks -purify Fortran *.f -autoindent -syntax fortran *.for -autoindent -syntax fortran *.FOR -autoindent -syntax fortran YACC *.y -autoindent -syntax yacc LEX *.l -autoindent -syntax lex TCL *.tcl -autoindent -syntax tcl Joe Syntax File *.jsf -autoindent -syntax conf Autoconfig file *.ac -autoindent -syntax conf M4 file *.m4 -autoindent -syntax m4 Automake file *.am -autoindent -syntax conf Mail file *tmp/mutt-* -wordwrap -syntax mail THIRD SECTION: Named help screens: Use \i to turn on/off inverse video Use \u to turn on/off underline Use \b to turn on/off bold Use \d to turn on/off dim Use \f to turn on/off flash {Basic \i Help Screen \|turn off with ^XH more help with ^X. \i \i \i\|\uCURSOR\u \|\uGO TO\u \|\uUNDO\u \|\uMISC\u \|\uREGION\u \|\uEXIT\u \|\i \i \i \i\|^B left ^F right \|^[V prev screen \|^XU undo \|^[^[ option \|^@ mark \|^XK quit \|\i \i \i \i\|^P up ^N down \|^V next screen \|^^ redo \|^[Q format \|^W cut \|^X^C save \|\i \i \i \i\|^[B prev. word \|^A beg of line \|\uDELETE\u \|^L refresh \|^Y paste \|\uFILE\u \|\i \i \i \i\|^[F next word \|^E end of line \|^D char \|^[$ spell \|^[Y switch \|^X^W save \|\i \i \i \i\|\uSEARCH\u \|^[< top of file \|^K >line \|^[M math \|^XA save \|^XI insert\|\i \i \i \i\|^S forward \|^[> end of file \|^[D >word \|^[% query \|^[| filter \|^X^F load \|\i \i \i \i\|^R backward \|^[G to line No. \|^[ DEL word<\| replace \|^XX swap \|^X^B switch\|\i \i } {Editing \i Help Screen \|turn off with ^XH prev. screen ^X, next screen ^X. \i \i \i\|\uCASE\u \|\uTRANSPOSE\u \|\uINSERT\u \|\uMACROS\u \|\uPROGRAMS\u \|\i \i \i \i\|^[U Up word \|^T Chars \|^O line \|^X( record \|^X^I Indent region \|\i \i \i \i\|^[L Down word \|^[T Words \|^C space \|^X) stop \|^[. Tags file find \|\i \i \i \i\|^[C Cap. word \|^X^T Lines \|` Ctrl- \|^XE play \|^XG To matching ( [ { \|\i \i \i \i\|^X^U Up region \| \|^XT text \|^XQ query suspend \|^XC Parse errors \|\i \i \i \i\|^X^L Down region\| \| \|^U repeat prefix \|^XN / ^XP next/prev err\|\i \i } {Window \i Help Screen \|turn off with ^XH prev. screen ^X, next screen ^X. \i \i \i\|\uWINDOW\u \|\uSCROLL\u \|\uSHELL\u \|\uCURSOR\u \|\i \i \i \i\|^X2 Split window in half \|^X^P up \|^Z Suspend \|^[P prev. paragraph \|\i \i \i \i\|^XO Switch to other window \|^X^N down \|^[! Command \|^[N next paragraph \|\i \i \i \i\|^XZ Grow window \|^X< left \|^[' Window \|^XG to matching ( [ { \|\i \i \i \i\|^X^Z Shrink window \|^X> right \| \|\uBOOKMARK\u \|\i \i \i \i\|^X0 Kill window \| \| \|^XJ set \|\i \i \i \i\|^X1 Kill all other windows \|^X= status\| \|^X/ goto \|\i \i } {Search \i Help Screen \|turn off with ^XH prev. screen ^X, next screen ^X. \i \i \iSpecial search sequences: \|\i \i \i \i \\^ \\$ matches beg./end of line \\? match any single char \|\i \i \i \i \\< \\> matches beg./end of word \\* match 0 or more chars \|\i \i \i \i \\c matches balanced C expression \\\\ matches a \\ \|\i \i \i \i \\[..] matches one of a set \\n matches a newline \|\i \i \i \i \\+ matches 0 or more of the character which follows the \\+ \|\i \i \i \iSpecial replace sequences: \|\i \i \i \i \\& replaced with text which matched search string \|\i \i \i \i \\0 - 9 replaced with text which matched Nth \\*, \\?, \\c, \\+, or \\[..] \|\i \i \i \i \\\\ replaced with \\ \\n replaced with newline \|\i \i } {Names \i Help Screen \|turn off with ^XH prev. screen ^X, next screen ^X. \i \i \i Hit TAB at file name prompts to generate menu of file names \|\i \i \i \i Or use up/down keys to access history of previously entered names \|\i \i \i \i Special file names: \|\i \i \i \i !command Pipe in/out of a shell command \|\i \i \i \i >>filename Append to a file \|\i \i \i \i - Read/Write to/from standard I/O \|\i \i \i \i filename,START,SIZE Read/Write a part of a file/device \|\i \i \i \i Give START/SIZE in decimal (255), octal (0377) or hex (0xFF) \|\i \i } {Joe \i Help Screen \|turn off with ^XH prev. screen ^X, \i \i \i Send bug reports to: http://sourceforge.net/projects/joe-editor \|\i \i } FOURTH SECTION: Key bindings: Section names you must provide: :main For editing window :prompt For prompt lines :query For single-character query lines :querya Singe-character query for quote :querysr Search & Replace single-character query Other sections may be given as well for organization purposes or for use with the '-keymap' option. Use: :inherit name To copy the named section into the current one :delete key To delete a key sequence from the current section Keys: Use ^@ through ^_ and ^? for Ctrl chars Use SP for space Use a TO b to generate a range of characters You can also use termcap string capability names. For example: .ku Up .kd Down .kl Left .kr Right .kh Home .kH End .kI Insert .kD Delete .kP PgUp .kN PgDn .k1 - .k9 F1 - F9 .k0 F0 or F10... you decide. .k; F10 Macros: Simple macros can be made by comma seperating 2 or more command names. For example: bof,bol ^T Z Goto beginning of last line Also quoted matter is typed in literally: bol,">",dnarw .k1 Quote news article line Macros may cross lines if they end with , :windows Bindings common to all windows type ^@ TO Self insert abort ^G Abort window abort ^X ^C abort ^C tw0 ^X 0 Delete window: can make orphan buffers tw1 ^X 1 Delete other windows: can make orphan buffers uarg ^U Repeat prefix uarg ^[ - uarg ^[ 0 TO 9 help ^X h Help help ^X ^H hnext ^X . hprev ^X , math ^[ m Calculator math ^[ M nextw ^X o Other window pgdn .kN Screen down pgdn ^V pgdn ^[ [ 6 ~ pgup .kP Screen up pgup ^[ v pgup ^[ [ 5 ~ play,"0" ^X e Execute keyboard macro prevw ^X p Previous window (uemacs) query ^X q Query insert record,"0" ^X ( Record macro retype ^L Refresh screen rtn ^M Return shell ^Z Suspend shell ^[ s Suspend (uemacs) stop ^X ) Stop recording macro :main Text editing window :inherit windows ESC-x compile :def compile querysave,query,scratch,"* Build Log *",rtn,bof,markb,eof," ",markk,blkdel,build Ispell :def ispellfile filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;cat ispell.tmp;/bin/rm ispell.tmp",rtn,retype :def ispellword psh,nextword,markk,prevword,markb,filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;tr -d $SPLTMP;aspell -x -c $SPLTMP /dev/tty;cat $SPLTMP;/bin/rm $SPLTMP",rtn,retype :def aspellword psh,nextword,markk,prevword,markb,filt,"SPLTMP=ispell.tmp;cat >$SPLTMP;aspell -x -c $SPLTMP /dev/tty;tr -d <$SPLTMP '\\012';/bin/rm $SPLTMP",rtn,retype,nextword aspellword ^[ $ ctrl ^Q Quote Ctrl chars ctrl ` Quote Ctrl chars insc ^[ [ 2 ~ insc ^[ [ L SCO delch ^[ [ 3 ~ pgup ^[ [ I SCO pgdn ^[ [ G SCO home ^[ [ 1 ~ Putty, Linux, Cygwin home ^[ [ H Xterm, Konsole, SCO home ^[ O H gnome-terminal home ^[ [ 7 ~ RxVT eol ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eol ^[ [ F Xterm, Konsole, SCO eol ^[ O F gnome-terminal eol ^[ [ 8 ~ RxVT Macros of non-existant emacs functions psh,nextword,markk,prevword,markb,upper,nextword ^[ u Upcase word psh,nextword,markk,prevword,markb,lower,nextword ^[ l Downcase word psh,nextword,markk,prevword,markb,lower,rtarw,markk,upper,nextword ^[ c Capitalize word psh,markk,lower ^X ^L Downcase region psh,markk,upper ^X ^U Upcase region psh,ltarw,markb,rtarw,markk,rtarw, blkmove,rtarw ^T Transpose chars psh,uparw,bol,markb,dnarw,markk, dnarw,blkmove,dnarw ^X ^T Transpose lines Old way- broken at end of line psh,prevword,markb,nextword, nextword,prevword,markk,nextword, nextword,prevword,blkmove,nextword ^[ t Transpose words psh,prevword,nextword,nextword,markk,prevword,markb,setmark,":", prevword,nextword,blkmove,markk,prevword,markb,gomark,":",blkmove,nextword ^[ t eop,bop,markb,eop ^[ h Mark paragraph nextword,prevword,markb,nextword ^[ @ Mark word "()",ltarw ^[ ( Insert () bol,insc,delw ^[ ^ Delete indentation psh,markk,copy,msg,"Region saved",rtn ^[ w Yank copy mode,"Rcol",rtn, msg,"Fill-column set",rtn ^X f Set right margin bol,rtn,backw,rtn,rtn,uparw,delw ^X ^O Delete blank lines " ",backw," ",insc,delw ^[ SP Just one space " ",backw,insc,delw ^[ \ Delete horizontal space stop,msg,"Abort",beep,rtn ^G Abort message stop,msg,"Abort",beep,rtn ^[ ^G Abort message stop,msg,"Abort",beep,rtn ^X ^G Abort message psh,markk,blkdel ^W Cut save,rtn ^X ^S Save file ask ^X s drop,msg,"Mark set",rtn ^@ Drop anchor nextw,pgdn,prevw ^[ ^V Scroll other window down nextw,pgup,prevw ^[ ^Z Scroll other window up bol,nedge,pedge ^[ m Gnu-emacs goto indentation nextw,nbuf,prevw ^X 4 b Switch buffers other window nextw,edit,query,prevw ^X 4 f Find file other window nextw,edit,query,prevw ^X 4 ^F nextw,tag,query,prevw ^X 4 . Find tag other window Old way... exsave ^X ^C Save file and exit More like gnu-emacs... querysave,query,killjoe ^X ^C Query to save files, then exit Old way... lose,query,abortbuf ^X k Kill buffer in window lose,query ^X k Kill buffer in window lose,query,edit ^X ^V Edit a file: no orphaned buffers psh,drop,fwrdc,query,markk,blkdel ^[ z Cut to char psh,markk,blksave,">>",query ^X a Append region to file retype, arg,"top+height/2-line",rtn,upslide ^L Recenter arg,"top+height/2-line",rtn,dnarw ^[ r Move to center line swap,math,"z=line",rtn, swap,msg,math,"line-z",rtn, " lines in region",rtn ^[ = Count lines region mode,"O" ^X ^Q Toggle read-only compile ^X c Compile nxterr ^X n nxterr ^X ` prverr ^X p backs ^? Backspace backs ^H backw ^[ ^? Backspace word backw ^[ ^H bknd ^X ' Shell window (joe) bof ^[ < Goto beginning of file bof ^X [ home .kh Goto beginning of line home ^A home ^[ [ H home ^[ [ 1 ~ bop ^[ p (uemacs) bufed ^X b bknd ^[ ' Shell window crawlr ^X > Scroll to the right crawll ^X < Scroll to the left delch .kD Delete character delch ^D deleol ^K Delete to end of line delw ^[ d Delete word dnarw .kd Go down dnarw ^N dnarw ^[ O B dnarw ^[ [ B dnslide ^X ^N Slide down (uemacs) edit ^X ^F Edit a file: creates orphaned buffers eof ^[ > Go to end of file eof ^X ] eol .kH Go to end of line eol .@7 eol ^E eol ^[ [ F eol ^[ [ 4 ~ eop ^[ n (uemacs) execmd ^[ x insc ^C (uemacs) ffirst ^S Search forward isrch ^S ffirst ^\ psh,markk,filt,query ^[ | Filter block format ^[ q Format paragraph gomark ^X / Goto bookmark groww ^X ^ Enlarge window groww ^X z (uemacs) insf ^X i Insert a file yapp ^[ ^W Append next kill line ^[ g Goto line (uemacs) ltarw .kl Go left ltarw ^B ltarw ^[ O D ltarw ^[ [ D mode ^[ ^[ Change modes nbuf ^X ^B Next buffer in current window nbuf ^X x (uemacs) nextpos ^K = Goto next position in position history nextword ^[ f Goto next word notmod ^[ ~ Not modified open ^O Split line open ^[ ^O pbuf ^X b Previous buffer in current window prevpos ^K - Goto previous position in position history prevword ^[ b Previous word qrepl ^[ % Query replace qrepl ^[ r Query replace (uemacs) qrepl ^[ ^R Query replace (uemacs) redo ^^ Redo changes rfirst ^R Search backwards rsrch ^R Incremental search backwards rindent ^X ^I Indent to the right rindent ^[ ^\ rtarw .kr Go right rtarw ^F rtarw ^[ O C rtarw ^[ [ C run ^[ ! save ^X ^W Write file setmark ^X j Set bookmark shrinkw ^X ^Z (uemacs) splitw ^X 2 Split window stat ^X l Gnu-Emacs Show status stat ^X ? JED stat ^X = Gnu-Emacs swap ^X ^X Swap mark and cursor tag ^[ . Tag search tomatch ^X g Goto matching parenthasis (joe) tomatch ^[ ^F (uemacs) txt ^X t Prompt for text to insert undo ^_ Undo changes undo ^X u uparw .ku Go up uparw ^P uparw ^[ O A uparw ^[ [ A upslide ^X ^P Slide up (uemacs) yank ^Y Yank deleted text yankpop ^[ y Yank-pop :prompt Prompt windows :inherit main abort ^G abort ^C complete ^I :menu Selection menus :inherit windows pgupmenu ^[ [ I pgdnmenu ^[ [ G bolmenu ^[ [ 1 ~ Putty, Linux, Cygwin bolmenu ^[ [ H Xterm, Konsole bolmenu ^[ O H gnome-terminal bolmenu ^[ [ 7 ~ RxVT eolmenu ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eolmenu ^[ [ F Xterm, Konsole eolmenu ^[ O F gnome-terminal eolmenu ^[ [ 8 ~ RxVT abort ^[ ^[ backsmenu ^? backsmenu ^H bofmenu ^K U bofmenu ^K ^U bofmenu ^K u bolmenu .kh bolmenu ^A dnarwmenu .kd dnarwmenu ^N dnarwmenu ^[ [ B dnarwmenu ^[ O B eofmenu ^K V eofmenu ^K ^V eofmenu ^K v eolmenu .kH eolmenu ^E ltarwmenu .kl ltarwmenu ^B ltarwmenu ^[ [ D ltarwmenu ^[ O D pgdnmenu .kN Screen down pgdnmenu ^V pgdnmenu ^[ [ 6 ~ pgupmenu .kP Screen up pgupmenu ^[ v pgupmenu ^[ [ 5 ~ rtarwmenu .kr rtarwmenu ^F rtarwmenu ^[ [ C rtarwmenu ^[ O C rtn SP rtn ^I rtn ^X H rtn ^X h rtn ^X ^H tabmenu ^I uparwmenu .ku uparwmenu ^P uparwmenu ^[ [ A uparwmenu ^[ O A :querysr Search & replace query window type ^@ TO :query Single-key query window :inherit windows :querya Single-key query window for quoting type ^@ TO 070701001a7072000081a40000181b0000000a00000001452452bb000065e7000000550000000100000000000000000000001800000000reloc/sfw/etc/joe/joerc Initialization file for JOE Standard Joe JOE looks for this file in: 1 - $HOME/.joerc 2 - ${prefix}/etc/joerc This file can include other files by placing the following include command in the first column: :include filename FIRST SECTION: Default global options (these options can also be specified on the command line. Also the NOXON, LINES, COLUMNS, DOPADDING and BAUD options can be specified in environment variables): Put each option you want set in the first column: -option Sets the option --option Clears the option -mid Cursor is recentered when scrolling is necessary -marking Text between ^KB and cursor is highlighted (use with -lightoff) -asis Characters 128 - 255 shown as-is -force Force final newline when files are saved -nobackups If you don't want backup files to be created -lightoff Turn off highlighting after block copy or move -exask ^KX always confirms file name -beep Beep on errors and when cursor goes past extremes -nosta Disable top-most status line -keepup %k and %c status line escape sequences updated frequently -pg nnn No. lines to keep for PgUp/PgDn -csmode ^KF after a pervious search does a ^L instead -backpath path Directory to store backup files -nonotice Disable copyright notice -noxon Attempt to turn off ^S/^Q processing -orphan Put extra files given on command line in orphaned buffers instead of in windows -dopadding Output pad characters (for when there is no tty handshaking) -lines nnn Set no. screen lines -baud nnn Set baud rate for terminal optimizations -columns nnn Set no. screen columns -help Start with help on -skiptop nnn Don't use top nnn lines of the screen -notite Don't send terminal initialization and termination strings: prevents restoration of screen on exit. -usetabs Use tabs to help optimize screen update. -assume_color Assume terminal has ANSI color support even if termcap/terminfo entry says that it doesn't. This only applies if the terminal otherwise looks like an ANSI terminal (support bold and capability starts with ESC [). -guess_crlf Automatically detect MS-DOS files and set -crlf appropriately -guess_indent Guess indent character (tab or space). -menu_explorer Stay in menu system when a directory is selected (otherwise directory is added to path and menu is closed). -icase Search is case insensitive by default. -wrap Search wraps -autoswap Swap markb with markk when necessary Status line definition strings. -lmsg defines the left-justified string and -rmsg defines the right-justified string. The first character of -rmsg is the background fill character. The following escape sequences can be used in these strings: %t 12 hour time %u 24 hour time %T O for overtype mode, I for insert mode %W W if wordwrap is enabled %I A if autoindent is enabled %X Rectangle mode indicator %n File name %m '(Modified)' if file has been changed %* '*' if file has been changed %R Read-only indicator %r Row (line) number %c Column number %o Byte offset into file %O Byte offset into file in hex %a Ascii value of character under cursor %A Ascii value of character under cursor in hex %p Percent of file cursor is at %l No. lines in file %k Entered prefix keys %S '*SHELL*' if there is a shell running in window %M Macro recording message %y Syntax %x Context (first non-indented line going backwards) These formatting escape sequences may also be given: \i Inverse \u Underline \b Bold \d Dim \f Blink -lmsg \i%k%T%W%I%X %n %m%y%R %M %x -rmsg %S Row %r Col %c %t Ctrl-K H for help SECOND SECTION: File name dependant local option settings: Each line with '*' in the first column indicates the modes which should be set for files whose name matches the regular expression. If more than one regular expression matches the file name, then the last matching one is chosen. A file contents regular expression may also be specified on a separate line with '+regex'. If this regular expresssion is given, then both the file name regex and the file contents regex must match for the options to apply. Here are the modes which can be set: -utf8 File is UTF-8 coded -syntax name Specify syntax (syntax file called 'name.jsf' will be loaded) -highlight Enable highlighting -smarthome Home key first moves cursor to beginning of line, then if hit again, to first non-blank character. -indentfirst Smart home goes to first non-blank character first, instead of going the beginning of line first. -smartbacks Backspace key deletes 'istep' number of 'indentc's if cursor is at first non-space character. -tab nnn Tab width -indentc nnn Indentation character (32 for space, 9 for tab) -istep nnn Number of indentation columns -spaces TAB inserts spaces instead of tabs. -purify Fix indentation if necessary for rindent, lindent and backs (for example if indentation uses a mix of tabs and spaces, and indentc is space, indentation will be converted to all spaces). -crlf File uses CR-LF at ends of lines -wordwrap Wordwrap -autoindent Auto indent -overwrite Overtype mode -picture Picture mode (right arrow can go past end of lines) -lmargin nnn Left margin -rmargin nnn Right margin -french One space after '.', '?' and '!' for wordwrap and paragraph reformat instead of two. Joe does not change the spacing you give, but sometimes it must put spacing in itself. This selects how much is inserted. -linums Enable line numbers on each line -rdonly File is read-only -keymap name Keymap to use if not 'main' -lmsg Status line definition strings- -rmsg see previous section for more info. -mnew macro Macro to execute when new files are loaded -mold macro Macro to execute when existing files are loaded -msnew macro Macro to execute when new files are saved -msold macro Macro to execute when existing files are saved -square Rectangular block mode Macros for the above options are in the same format as in the key binding section below- but without the key name strings. Default local options -highlight -istep 2 No '.' in file name? Assume it's a text file and we want wordwrap on. * -wordwrap File name with '.'? It's probably not a text file. *.* Diff * +--- -syntax diff * +*** -syntax diff * +\[1-9]\+\[0-9]\[cda] -syntax diff Text file. *.txt -wordwrap Assembly language *.asm -wordwrap -syntax asm *.s -wordwrap -syntax asm *.S -wordwrap -syntax asm Mason *.mas -autoindent -syntax mason -smarthome -smartbacks Perl * +#!\+\[ ]\+\[a-z/]/perl\> -autoindent -syntax perl -smarthome -smartbacks *.pl -autoindent -syntax perl -smarthome -smartbacks *.pm -autoindent -syntax perl -smarthome -smartbacks C language file *.c -autoindent -syntax c -smarthome -smartbacks -purify *.cpp -autoindent -syntax c -smarthome -smartbacks -purify *.c++ -autoindent -syntax c -smarthome -smartbacks -purify C language header file *.h -autoindent -syntax c -smarthome -smartbacks -purify *.hpp -autoindent -syntax c -smarthome -smartbacks -purify *.h++ -autoindent -syntax c -smarthome -smartbacks -purify Verilog file *.v -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify Verilog header file *.vh -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify VHDL file *.vhd -autoindent -syntax vhdl -istep 2 -smarthome -smartbacks -purify XML *.xml -wordwrap -autoindent -syntax xml HTML *.htm -wordwrap -autoindent -syntax html *.html -wordwrap -autoindent -syntax html JAVA *.java -autoindent -syntax java -smarthome -smartbacks -purify Hypertext preprocessor file *.php -autoindent -syntax php -smarthome -smartbacks -purify Python * +#!\+\[ ]\+\[a-z/]/python\> -autoindent -syntax python -smarthome -smartbacks -purify *.py -autoindent -syntax python -smarthome -smartbacks -purify CSH * +#!\+\[ ]\+\[a-z/]/csh\> -autoindent -syntax csh *.csh -autoindent -syntax csh *.login -autoindent -syntax csh *.logout -autoindent -syntax csh TCSH * +#!\+\[ ]\+\[a-z/]/tcsh\> -autoindent -syntax csh *.tcsh -autoindent -syntax csh *.tcshrc -autoindent -syntax csh Shell * +#!\+\[ ]\+\[a-z/]/sh\> -autoindent -syntax sh *.sh -autoindent -syntax sh *profile -autoindent -syntax sh BASH Shell * +#!\+\[ ]\+\[a-z/]/bash\> -autoindent -syntax sh *.bash -autoindent -syntax sh *.bash_login -autoindent -syntax sh *.bash_logout -autoindent -syntax sh LISP *.lisp -autoindent -syntax lisp *.lsp -autoindent -syntax lisp *.el -autoindent -syntax lisp KSH * +#!\+\[ ]\+\[a-z/]/ksh\> -autoindent -syntax sh *.ksh -autoindent -syntax sh Makefile *akefile -autoindent -syntax conf *AKEFILE -autoindent -syntax conf Pascal *.p -autoindent -syntax pascal -smarthome -smartbacks -purify *.pas -autoindent -syntax pascal -smarthome -smartbacks -purify Fortran *.f -autoindent -syntax fortran *.for -autoindent -syntax fortran *.FOR -autoindent -syntax fortran YACC *.y -autoindent -syntax yacc LEX *.l -autoindent -syntax lex TCL *.tcl -autoindent -syntax tcl Joe Syntax File *.jsf -autoindent -syntax conf Autoconfig file *.ac -autoindent -syntax conf M4 file *.m4 -autoindent -syntax m4 Automake file *.am -autoindent -syntax conf Mail file *tmp/mutt-* -wordwrap -syntax mail THIRD SECTION: Named help screens: Use \i to turn on/off inverse video Use \u to turn on/off underline Use \b to turn on/off bold Use \d to turn on/off dim Use \f to turn on/off flash Use \| to insert a spring: all springs in a given line are set to the same width such that the entire line exactly fits in the width of the screen (if it's not an exact multiple so that there are N spaces remaining, the rightmost N springs each get one extra space). Hint: if you want vertical alignment, each line should have the same number of springs. {Basic \i Help Screen \|turn off with ^KH more help with ESC . (^[.) \i \i \i\|\uCURSOR\u \|\uGO TO\u \|\uBLOCK\u \|\uDELETE\u \|\uMISC\u \|\uEXIT\u \|\i \i \i \i\|^B left ^F right \|^U prev. screen \|^KB begin \|^D char. \|^KJ reformat \|^KX save \|\i \i \i \i\|^P up ^N down \|^V next screen \|^KK end \|^Y line \|^T options \|^C abort \|\i \i \i \i\|^Z previous word \|^A beg. of line \|^KM move \|^W >word \|^R refresh \|^KZ shell \|\i \i \i \i\|^X next word \|^E end of line \|^KC copy \|^O word< \|^@ insert \|\uFILE\u \|\i \i \i \i\|\uSEARCH\u \|^KU top of file \|^KW file \|^J >line \|\uSPELL\u \|^KE edit \|\i \i \i \i\|^KF find text \|^KV end of file \|^KY delete \|^_ undo \|^[N word \|^KR insert\|\i \i \i \i\|^L find next \|^KL to line No. \|^K/ filter \|^^ redo \|^[L file \|^KD save \|\i \i } {Windows \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i\|^KO Split the window in half \|^KE Load file into window \|\i \i \i \i\|^KG Make current window bigger \|^KT Make current window smaller \|\i \i \i \i\|^KN Go to the window below \|^KP Go to the window above \|\i \i \i \i\|^C Eliminate the current window \|^KI Show all windows / Show one window\|\i \i } {Advanced \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i\|\uMACROS\u \|\uMISC\u \|\uSCROLL\u \|\uSHELL\u \|\uGOTO\u \|\uI-SEARCH\u \|\i \i \i \i\|^K[ 0-9 Record \|^K SPACE status \|^[W Up \|^K' Window \|^[B To ^KB \|^[R Backwards\|\i \i \i \i\|^K] Stop \|^K\\ Repeat \|^[Z Down \|^[! Command \|^[K To ^KK \|^[S Forwards \|\i \i \i \i\|^K 0-9 Play \|^[M Math \|^K< Left \|\uQUOTE\u \|\uDELETE\u \|\uBOOKMARKS\u \|\i \i \i \i\|^K? Query \|^KA Center line \|^K> Right \|` Ctrl- \|^[Y yank \|^[ 0-9 Goto \|\i \i \i \i\|^[D Dump \|^[H Message \| \|^\\ Meta- \|^[O line< \|^[^[ Set \|\i \i } {Programs \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i\|\uGOTO\u \|\uINDENT\u \|\uCOMPILING\u \|\i \i \i \i\|^G Matching ( [ { \|^K, less \|^[C Compile and parse errors \|\i \i \i \i\|^K- Previous place \|^K. more \|^[E Parse errors \|\i \i \i \i\|^K= Next place \| \|^[= To next error \|\i \i \i \i\|^K; Tags file search \| \|^[- To prev. error \|\i \i } {Search \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \iSpecial search sequences: \|\i \i \i \i \\^ \\$ matches beg./end of line \\? match any single char \|\i \i \i \i \\< \\> matches beg./end of word \\* match 0 or more chars \|\i \i \i \i \\c matches balanced C expression \\\\ matches a \\ \|\i \i \i \i \\[..] matches one of a set \\n matches a newline \|\i \i \i \i \\+ matches 0 or more of the character which follows the \\+ \|\i \i \i \iSpecial replace sequences: \|\i \i \i \i \\& replaced with text which matched search string \|\i \i \i \i \\0 - 9 replaced with text which matched Nth \\*, \\?, \\c, \\+, or \\[..] \|\i \i \i \i \\\\ replaced with \\ \\n replaced with newline \|\i \i } {Names \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i Hit TAB at file name prompts to generate menu of file names \|\i \i \i \i Or use up/down keys to access history of previously entered names \|\i \i \i \i Special file names: \|\i \i \i \i !command Pipe in/out of a shell command \|\i \i \i \i >>filename Append to a file \|\i \i \i \i - Read/Write to/from standard I/O \|\i \i \i \i filename,START,SIZE Read/Write a part of a file/device \|\i \i \i \i Give START/SIZE in decimal (255), octal (0377) or hex (0xFF) \|\i \i } {Joe \i Help Screen \|turn off with ^KH prev. screen ^[, \i \i \i Send bug reports to: http://sourceforge.net/projects/joe-editor \|\i \i } FOURTH SECTION: Key bindings: Section names you must provide: :main For editing window :prompt For prompt lines :query For single-character query lines :querya Singe-character query for quote :querysr Search & Replace single-character query Other sections may be given as well for organization purposes or for use with the '-keymap' option. Use: :inherit name To copy the named section into the current one :delete key To delete a key sequence from the current section Keys: Use ^@ through ^_ and ^? for Ctrl chars Use SP for space Use a TO b to generate a range of characters You can also use termcap string capability names. For example: .ku Up .kd Down .kl Left .kr Right .kh Home .kH End .kI Insert .kD Delete .kP PgUp .kN PgDn .k1 - .k9 F1 - F9 .k0 F0 or F10 .k; F10 Macros: Simple macros can be made by comma seperating 2 or more command names. For example: eof,bol ^T Z Goto beginning of last line Also quoted matter is typed in literally: bol,">",dnarw .k1 Quote news article line Macros may cross lines if they end with , Commands or named macros may be created with :def. For example, you can use: :def foo eof,bol To define a command foo which will goto the beginning of the last line. :windows Bindings common to all windows type ^@ TO Type a character abort ^C Abort window abort ^K Q abort ^K ^Q abort ^K q arg ^K \ Repeat next command explode ^K I Show all windows or show only one window explode ^K ^I explode ^K i help ^K H Help menu help ^K ^H help ^K h hnext ^[ . Next help window hprev ^[ , Previous help window math ^[ m Calculator math ^[ M Calculator math ^[ ^M Calculator msg ^[ h Display a message msg ^[ H Display a message msg ^[ ^H Display a message nextw ^K N Goto next window nextw ^K ^N nextw ^K n pgdn .kN Screen down pgdn ^V pgdn ^[ [ 6 ~ pgup .kP Screen up pgup ^U pgup ^[ [ 5 ~ play ^K 0 TO 9 Execute macro prevw ^K P Goto previous window prevw ^K ^P prevw ^K p query ^K ? Macro query insert record ^K [ Record a macro retype ^R Refresh screen rtn ^M Return shell ^K Z Shell escape shell ^K ^Z shell ^K z stop ^K ] Stop recording :main Text editing window :inherit windows Spell-check macros Ispell :def ispellfile filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;cat ispell.tmp;/bin/rm ispell.tmp",rtn,retype :def ispellword psh,nextword,markk,prevword,markb,filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;tr -d $SPLTMP;aspell -x -c $SPLTMP /dev/tty;cat $SPLTMP;/bin/rm $SPLTMP",rtn,retype :def aspellword psh,nextword,markk,prevword,markb,filt,"SPLTMP=ispell.tmp;cat >$SPLTMP;aspell -x -c $SPLTMP /dev/tty;tr -d <$SPLTMP '\\012';/bin/rm $SPLTMP",rtn,retype,nextword aspellfile ^[ l aspellword ^[ n Compile :def compile switch,"*Build-Log*",rtn,markb,eof," ",markk,blkdel,filt,query,parserr :def compile querysave,query,scratch,"* Build Log *",rtn,bof,markb,eof," ",markk,blkdel,build Here we guess some common key sequences which either do not have termcap sequences or which are frequently wrong. Note that if the termcap entry is correct, it will override these later on. insc ^[ [ 2 ~ insc ^[ [ L SCO delch ^[ [ 3 ~ pgup ^[ [ I SCO pgdn ^[ [ G SCO home ^[ [ 1 ~ Putty, Linux, Cygwin home ^[ [ H Xterm, Konsole, SCO home ^[ O H gnome-terminal home ^[ [ 7 ~ RxVT eol ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eol ^[ [ F Xterm, Konsole, SCO eol ^[ O F gnome-terminal eol ^[ [ 8 ~ RxVT begin_marking,rtarw,toggle_marking ^[ [ 1 ; 5 C Mark right Xterm begin_marking,rtarw,toggle_marking ^[ [ 5 C Mark right Gnome-terminal (Almost all termcap entries have ^[ O C as an arrow key). begin_marking,rtarw,toggle_marking ^[ O C Mark right Putty Ctrl-rtarw begin_marking,rtarw,toggle_marking ^[ O c Mark right RxVT Ctrl-rtarw begin_marking,ltarw,toggle_marking ^[ [ 1 ; 5 D Mark left begin_marking,ltarw,toggle_marking ^[ [ 5 D Mark left begin_marking,ltarw,toggle_marking ^[ O D Mark left Putty Ctrl-ltarw begin_marking,ltarw,toggle_marking ^[ O d Mark left RxVT Ctrl-ltarw begin_marking,uparw,toggle_marking ^[ [ 1 ; 5 A Mark up begin_marking,uparw,toggle_marking ^[ [ 5 A Mark up begin_marking,uparw,toggle_marking ^[ O A Mark up Putty Ctrl-uparw begin_marking,uparw,toggle_marking ^[ O a Mark up RxVT Ctrl-uparw begin_marking,dnarw,toggle_marking ^[ [ 1 ; 5 B Mark down begin_marking,dnarw,toggle_marking ^[ [ 5 B Mark down begin_marking,dnarw,toggle_marking ^[ O B Mark down Putty Ctrl-dnarw begin_marking,dnarw,toggle_marking ^[ O b Mark down RxVT Ctrl-dnarw blkdel,nmark ^[ [ 3 ; 5 - Gnome-terminal Ctrl-Del blkdel,nmark ^[ [ 3 ; 5 ~ Xterm Ctrl-Del yank ^[ [ 2 ; 5 - Gnome-terminal Ctrl-Ins yank ^[ [ 2 ; 5 ~ Xterm Ctrl-Ins Extra functions not really part of JOE user interface: delbol ^[ o Delete to beginning of line delbol ^[ ^O Delete to beginning of line dnslide ^[ z Scroll down one line dnslide ^[ Z Scroll down one line dnslide ^[ ^Z Scroll down one line compile ^[ c Compile compile ^[ ^C Compile execmd ^[ x Prompt for command to execute execmd ^[ X Prompt for command to execute execmd ^[ ^X Prompt for command to execute finish ^[ ^I Complete word in document finish ^[ ^M Complete word: used to be math isrch ^[ s Forward incremental search isrch ^[ S Forward incremental search isrch ^[ ^S Forward incremental search notmod ^[ ~ Not modified nxterr ^[ = To next error parserr ^[ e Parse errors in current buffer parserr ^[ E Parse errors in current buffer parserr ^[ ^E Parse errors in current buffer prverr ^[ - To previous error rsrch ^[ r Backward incremental search rsrch ^[ R Backward incremental search rsrch ^[ ^R Backward incremental search run ^[ ! Run a program in a window tomarkb ^[ b Go to beginning of marked block tomarkb ^[ ^B Go to beginning of marked block tomarkk ^[ k Go to end of marked block tomarkk ^[ ^K Go to end of marked block tomarkk ^[ K Go to end of marked block txt ^[ i Prompt for text and insert it txt ^[ I Prompt for text and insert it upslide ^[ w Scroll up one line upslide ^[ ^W Scroll up one line upslide ^[ W Scroll up one line yank ^[ y Undelete text yankpop ^[ ^Y Undelete text yank ^[ Y Undelete text toggle_marking ^@ Ctrl-space block selection method Ctrl-space used to insert a space bufed ^[ d Menu of buffers nbuf ^[ v Next buffer nbuf ^[ V Next buffer nbuf ^[ ^V Next buffer pbuf ^[ u Prev buffer pbuf ^[ U Prev buffer pbuf ^[ ^U Prev buffer query ^[ q Quoted insert byte ^[ n Goto byte col ^[ c Goto column abortbuf ^[ k Kill current buffer- don't mess with windows ask ^[ a Ask to save current buffer bop ^[ p Backwards paragraph bos ^[ x Bottom of screen copy ^[ ^W Copy block into yank dupw ^[ \ Split window eop ^[ n Forwards paragraph format ^[ j Format paragraph ignore block markl ^[ l Mark line nmark ^[ @ Turn off ^KB ^KK pop ^[ > Pop ^KB ^KK psh ^[ < Push ^KB ^KK swap ^[ x Swap ^KB and cursor tomarkbk ^[ g Switch between beginning and end of marked tos ^[ e Top of screen tw0 ^[ 0 Kill current window (orphans buffer) tw1 ^[ 1 Kill all other windows (orphans buffers) uarg ^[ u Universal argument yank ^[ ^Y Undelete previous text yapp ^[ w Append next delete to previous yank Standard JOE user interface quote8 ^\ Enter Meta chars quote ` Enter Ctrl chars backs ^? Backspace backs ^H backw ^O Backspace word bknd ^K ' Shell window blkcpy ^K C Copy marked block blkcpy ^K ^C blkcpy ^K c blkdel ^K Y Delete marked block blkdel ^K ^Y blkdel ^K y blkmove ^K M Move marked block blkmove ^K ^M blkmove ^K m blksave ^K W Save marked block blksave ^K ^W blksave ^K w bof ^K U Goto beginning of file bof ^K ^U bof ^K u bol .kh Goto beginning of line bol ^A home .kh home ^A center ^K A Center line center ^K ^A center ^K a crawll ^K < Pan left crawlr ^K > Pan right delch .kD Delete character delch ^D deleol ^J Delete to end of line dellin ^Y Delete entire line delw ^W Delete word to right dnarw .kd Go down dnarw ^N dnarw ^[ O B dnarw ^[ [ B edit ^K E Edit a file edit ^K ^E edit ^K e eof ^K V Go to end of file eof ^K ^V eof ^K v eol .kH Go to end of line eol .@7 eol ^E exsave ^K X Save and exit exsave ^K ^X exsave ^K x ffirst ^K F Find first ffirst ^K ^F ffirst ^K f filt ^K / Filter block finish ^K ^M Complete text under cursor fnext ^L Find next fmtblk ^K J Format paragraphs in block fmtblk ^K ^J fmtblk ^K j gomark ^[ 0 TO 9 Goto bookmark groww ^K G Grow window groww ^K ^G groww ^K g insc .kI Insert a space insc ^@ insf ^K R Insert a file insf ^K ^R insf ^K r lindent ^K , Indent to left line ^K L Goto line no. line ^K ^L line ^K l ltarw .kl Go left ltarw ^B ltarw ^[ O D ltarw ^[ [ D macros ^[ d Dump keyboard macros macros ^[ ^D markb ^K B Set beginning of marked block markb ^K ^B markb ^K b markk ^K K Set end of marked block markk ^K ^K markk ^K k mode ^T Options menu nextpos ^K = Goto next position in position history nextword ^X Goto next word open ^] Split line prevpos ^K - Previous position in history prevword ^Z Previous word redo ^^ Redo changes rindent ^K . Indent to right rtarw .kr Go right rtarw ^F rtarw ^[ O C rtarw ^[ [ C run ^K ! Run a shell command save ^K D Save file save ^K S save ^K ^D save ^K ^S save ^K d save ^K s setmark ^[ ^[ Set bookmark shrinkw ^K T Shrink window shrinkw ^K ^T shrinkw ^K t splitw ^K O Split window splitw ^K ^O splitw ^K o stat ^K SP Show status tag ^K ; Tags file search tomatch ^G Goto matching parenthasis undo ^_ Undo changes uparw .ku Go up uparw ^P uparw ^[ O A uparw ^[ [ A :prompt Prompt windows :inherit main complete ^I :menu Selection menus :inherit windows pgupmenu ^[ [ I pgdnmenu ^[ [ G bolmenu ^[ [ 1 ~ Putty, Linux, Cygwin bolmenu ^[ [ H Xterm, Konsole bolmenu ^[ O H gnome-terminal bolmenu ^[ [ 7 ~ RxVT eolmenu ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eolmenu ^[ [ F Xterm, Konsole eolmenu ^[ O F gnome-terminal eolmenu ^[ [ 8 ~ RxVT abort ^[ ^[ Why? backsmenu ^? backsmenu ^H bofmenu ^K U bofmenu ^K ^U bofmenu ^K u bolmenu .kh bolmenu ^A dnarwmenu .kd dnarwmenu ^N dnarwmenu ^[ [ B dnarwmenu ^[ O B eofmenu ^K V eofmenu ^K ^V eofmenu ^K v eolmenu .kH eolmenu ^E ltarwmenu .kl ltarwmenu ^B ltarwmenu ^[ [ D ltarwmenu ^[ O D pgdnmenu .kN Screen down pgdnmenu ^V pgdnmenu ^[ [ 6 ~ pgupmenu .kP Screen up pgupmenu ^U pgupmenu ^[ [ 5 ~ rtarwmenu .kr rtarwmenu ^F rtarwmenu ^[ [ C rtarwmenu ^[ O C rtn SP rtn ^I rtn ^K H rtn ^K h rtn ^K ^H tabmenu ^I uparwmenu .ku uparwmenu ^P uparwmenu ^[ [ A uparwmenu ^[ O A :query Single-key query window :inherit windows :querya Single-key query window for quoting type ^@ TO :querysr Search & replace query window type ^@ TO 070701001a7073000081a40000181b0000000a00000001452452bb00004dc6000000550000000100000000000000000000001a00000000reloc/sfw/etc/joe/jpicorc Initialization file for JOE Super Pico JOE looks for this file in: 1 - $HOME/.jpicorc 2 - ${prefix}/etc/jpicorc This file can include other files by placing the following include command in the first column: :include filename FIRST SECTION: Default global options (these options can also be specified on the command line. Also the NOXON, LINES, COLUMNS, DOPADDING and BAUD options can be specified in environment variables): Put each option you want set in the first column: -option Sets the option --option Clears the option -mid Cursor is recentered when scrolling is necessary -marking Text between ^KB and cursor is highlighted (use with -lightoff) -asis Characters 128 - 255 shown as-is -force Force final newline when files are saved -nobackups If you don't want backup files to be created -lightoff Turn off highlighting after block copy or move -exask ^KX always confirms file name -beep Beep on errors and when cursor goes past extremes -nosta Disable top-most status line -keepup %k and %c status line escape sequences updated frequently -pg nnn No. lines to keep for PgUp/PgDn -csmode ^KF after a pervious search does a ^L instead -backpath path Directory to store backup files -nonotice Disable copyright notice -noxon Attempt to turn off ^S/^Q processing -orphan Put extra files given on command line in orphaned buffers instead of in windows -dopadding Output pad characters (for when there is no tty handshaking) -lines nnn Set no. screen lines -baud nnn Set baud rate for terminal optimizations -columns nnn Set no. screen columns -help Start with help on -skiptop nnn Don't use top nnn lines of the screen -notite Don't send terminal initialization and termination strings: prevents restoration of screen on exit. -usetabs Use tabs to help optimize screen update. -assume_color Assume terminal has ANSI color support even if termcap/terminfo entry says that it doesn't. This only applies if the terminal otherwise looks like an ANSI terminal (support bold and capability starts with ESC [). -guess_crlf Automatically detect MS-DOS files and set -crlf appropriately -guess_indent Guess indent character (tab or space). -menu_explorer Stay in menu system when a directory is selected (otherwise directory is added to path and menu is closed). -icase Search is case insensitive by default. -wrap Search wraps Status line definition strings. -lmsg defines the left-justified string and -rmsg defines the right-justified string. The first character of -rmsg is the background fill character. The following escape sequences can be used in these strings: %t 12 hour time %u 24 hour time %T O for overtype mode, I for insert mode %W W if wordwrap is enabled %I A if autoindent is enabled %X Rectangle mode indicator %n File name %m '(Modified)' if file has been changed %* '*' if file has been changed %R Read-only indicator %r Row (line) number %c Column number %o Byte offset into file %O Byte offset into file in hex %a Ascii value of character under cursor %A Ascii value of character under cursor in hex %p Percent of file cursor is at %l No. lines in file %k Entered prefix keys %S '*SHELL*' if there is a shell running in window %M Macro recording message %y Syntax These formatting escape sequences may also be given: \i Inverse \u Underline \b Bold \d Dim \f Blink -lmsg \i%k%T%W%I%X %n %m%y%R %M -rmsg %S Row %r Col %c %t Ctrl-G for help SECOND SECTION: File name dependant local option settings: Each line with '*' in the first column indicates the modes which should be set for files which match the regular expression. If more than one regular expression matches the file name, then the last matching one is chosen. Here are the modes which can be set: -utf8 File is UTF-8 coded -syntax name Specify syntax (syntax file called 'name.jsf' will be loaded) -highlight Enable highlighting -smarthome Home key first moves cursor to beginning of line, then if hit again, to first non-blank character. -indentfirst Smart home goes to first non-blank character first, instead of going the beginning of line first. -smartbacks Backspace key deletes 'istep' number of 'indentc's if cursor is at first non-space character. -tab nnn Tab width -indentc nnn Indentation character (32 for space, 9 for tab) -istep nnn Number of indentation columns -spaces TAB inserts spaces instead of tabs. -purify Fix indentation if necessary for rindent, lindent and backs (for example if indentation uses a mix of tabs and spaces, and indentc is space, indentation will be converted to all spaces). -crlf File uses CR-LF at ends of lines -wordwrap Wordwrap -autoindent Auto indent -overwrite Overtype mode -picture Picture mode (right arrow can go past end of lines) -lmargin nnn Left margin -rmargin nnn Right margin -french One space after '.', '?' and '!' for wordwrap and paragraph reformat instead of two. Joe does not change the spacing you give, but sometimes it must put spacing in itself. This selects how much is inserted. -linums Enable line numbers on each line -rdonly File is read-only -keymap name Keymap to use if not 'main' -lmsg Status line definition strings- -rmsg see previous section for more info. -mnew macro Macro to execute when new files are loaded -mold macro Macro to execute when existing files are loaded -msnew macro Macro to execute when new files are saved -msold macro Macro to execute when existing files are saved -square Rectangular block mode Macros for the above options are in the same format as in the key binding section below- but without the key name strings. Default local options -highlight -istep 2 No '.' in file name? Assume it's a text file and we want wordwrap on. * -wordwrap File name with '.'? It's probably not a text file. *.* Diff * +--- -syntax diff * +*** -syntax diff * +\[1-9]\+\[0-9]\[cda] -syntax diff Text file. *.txt -wordwrap Assembly language *.asm -wordwrap -syntax asm *.s -wordwrap -syntax asm *.S -wordwrap -syntax asm Mason *.mas -autoindent -syntax mason -smarthome -smartbacks Perl * +#!\+\[ ]\+\[a-z/]/perl\> -autoindent -syntax perl -smarthome -smartbacks *.pl -autoindent -syntax perl -smarthome -smartbacks *.pm -autoindent -syntax perl -smarthome -smartbacks C language file *.c -autoindent -syntax c -smarthome -smartbacks -purify *.cpp -autoindent -syntax c -smarthome -smartbacks -purify *.c++ -autoindent -syntax c -smarthome -smartbacks -purify C language header file *.h -autoindent -syntax c -smarthome -smartbacks -purify *.hpp -autoindent -syntax c -smarthome -smartbacks -purify *.h++ -autoindent -syntax c -smarthome -smartbacks -purify Verilog file *.v -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify Verilog header file *.vh -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify VHDL file *.vhd -autoindent -syntax vhdl -istep 2 -smarthome -smartbacks -purify XML *.xml -wordwrap -autoindent -syntax xml HTML *.htm -wordwrap -autoindent -syntax html *.html -wordwrap -autoindent -syntax html JAVA *.java -autoindent -syntax java -smarthome -smartbacks -purify Hypertext preprocessor file *.php -autoindent -syntax php -smarthome -smartbacks -purify Python * +#!\+\[ ]\+\[a-z/]/python\> -autoindent -syntax python -smarthome -smartbacks -purify *.py -autoindent -syntax python -smarthome -smartbacks -purify CSH * +#!\+\[ ]\+\[a-z/]/csh\> -autoindent -syntax csh *.csh -autoindent -syntax csh *.cshrc -autoindent -syntax csh *.login -autoindent -syntax csh *.logout -autoindent -syntax csh TCSH * +#!\+\[ ]\+\[a-z/]/tcsh\> -autoindent -syntax csh *.tcsh -autoindent -syntax csh *.tcshrc -autoindent -syntax csh Shell * +#!\+\[ ]\+\[a-z/]/sh\> -autoindent -syntax sh *.sh -autoindent -syntax sh *profile -autoindent -syntax sh BASH Shell * +#!\+\[ ]\+\[a-z/]/bash\> -autoindent -syntax sh *.bash -autoindent -syntax sh *.bash_login -autoindent -syntax sh *.bash_logout -autoindent -syntax sh KSH * +#!\+\[ ]\+\[a-z/]/ksh\> -autoindent -syntax sh *.ksh -autoindent -syntax sh LISP *.lisp -autoindent -syntax lisp *.lsp -autoindent -syntax lisp *.el -autoindent -syntax lisp Makefile *akefile -autoindent -syntax conf *AKEFILE -autoindent -syntax conf Pascal *.p -autoindent -syntax pascal -smarthome -smartbacks -purify *.pas -autoindent -syntax pascal -smarthome -smartbacks -purify Fortran *.f -autoindent -syntax fortran *.for -autoindent -syntax fortran *.FOR -autoindent -syntax fortran YACC *.y -autoindent -syntax yacc LEX *.l -autoindent -syntax lex TCL *.tcl -autoindent -syntax tcl Joe Syntax File *.jsf -autoindent -syntax conf Autoconfig file *.ac -autoindent -syntax conf M4 file *.m4 -autoindent -syntax m4 Automake file *.am -autoindent -syntax conf Mail file *tmp/mutt-* -wordwrap -syntax mail THIRD SECTION: Named help screens: Use \i to turn on/off inverse video Use \u to turn on/off underline Use \b to turn on/off bold Use \d to turn on/off dim Use \f to turn on/off flash {Basic \|\b^K\b cut line \| \b^W\b find first \|\b^J\b justify \| \b^X\b save or discard, exit \| \|\b^U\b paste \|\bEsc W\b find next \|\b^T\b spell \|\bEsc .\b for more help \| } {Basic1 \i Help Screen \|turn off with ^G prev. screen ^[, next screen ^[. \i \i \i\|\uCURSOR\u \|\uGO TO\u \|\uBLOCK\u \|\uDELETE\u \|\uMISC\u \|\uEXIT\u \|\i \i \i \i\|^B left ^F right \|^W^Y top of file \|^^ mark \|^D char \|^J format \|^X save \|\i \i \i \i\|^P up ^N down \|^W^V end of file \|^K cut \|^K line \|^T spell \|^C status\|\i \i \i \i\|^Y prev. screen \|^A beg. of line \|^U paste \|^[K >line \|^[T file \|^[Z shell\|\i \i \i \i\|^V next screen \|^E end of line \|^O save \|^[H word< \|^L refresh \|\uFILE\u \|\i \i \i \i\|^Z prev. word \|^W^T line No. \|^[/ filter \|^[D >word \|^[^[ options \|^O save \|\i \i \i \i\|^SPACE next word \|^W find ^[W next \| \|^[- undo \|^[= redo \|^R insert\|\i \i } {Advanced \i Help Screen \|turn off with ^G prev. screen ^[, next screen ^[. \i \i \i\|\uMACROS\u \|\uWINDOW\u \|\uWINDOW\u \|\uSHELL\u \|\uMISC\u \|\i \i \i \i\|^[( 0-9 Record \|^[O Split \|^[G Grow \|^[! Command \|^[X Execute command \|\i \i \i \i\|^[) Stop \|^[E Edit file \|^[J Shrink \|^[' Window \|^[M Math \|\i \i \i \i\|^[ 0-9 Play \|^[P Goto prev. \|\uQUOTE\u \|\uI-SEARCH\u \|^[C Center line \|\i \i \i \i\|^[? Query \|^[N Goto next \|` Ctrl- \|^[R Backwards \|^[] to matching ( [ {\|\i \i \i \i\|^[\\ Repeat \|^[I Zoom in/out \|^\\ Meta- \|^[S Forwards \|^[< ^[> pan left/rght\|\i \i } {Search \i Help Screen \|turn off with ^G prev. screen ^[, next screen ^[. \i \i \iSpecial search sequences: \|\i \i \i \i \\^ \\$ matches beg./end of line \\? match any single char \|\i \i \i \i \\< \\> matches beg./end of word \\* match 0 or more chars \|\i \i \i \i \\c matches balanced C expression \\\\ matches a \\ \|\i \i \i \i \\[..] matches one of a set \\n matches a newline \|\i \i \i \i \\+ matches 0 or more of the character which follows the \\+ \|\i \i \i \iSpecial replace sequences: \|\i \i \i \i \\& replaced with text which matched search string \|\i \i \i \i \\0 - 9 replaced with text which matched Nth \\*, \\?, \\c, \\+, or \\[..] \|\i \i \i \i \\\\ replaced with \\ \\n replaced with newline \|\i \i } {Names \i Help Screen \|turn off with ^G prev. screen ^[, next screen ^[. \i \i \i Hit TAB at file name prompts to generate menu of file names \|\i \i \i \i Or use up/down keys to access history of previously entered names \|\i \i \i \i Special file names: \|\i \i \i \i !command Pipe in/out of a shell command \|\i \i \i \i >>filename Append to a file \|\i \i \i \i - Read/Write to/from standard I/O \|\i \i \i \i filename,START,SIZE Read/Write a part of a file/device \|\i \i \i \i Give START/SIZE in decimal (255), octal (0377) or hex (0xFF) \|\i \i } {Joe \i Help Screen \|turn off with ^G prev. screen ^[, \i \i \i Send bug reports to: http://sourceforge.net/projects/joe-editor \|\i \i } FOURTH SECTION: Key bindings: Section names you must provide: :main For editing window :prompt For prompt lines :query For single-character query lines :querya Singe-character query for quote :querysr Search & Replace single-character query Other sections may be given as well for organization purposes or for use with the '-keymap' option. Use: :inherit name To copy the named section into the current one :delete key To delete a key sequence from the current section Keys: Use ^@ through ^_ and ^? for Ctrl chars Use SP for space Use a TO b to generate a range of characters You can also use termcap string capability names. For example: .ku Up .kd Down .kl Left .kr Right .kh Home .kH End .kI Insert .kD Delete .kP PgUp .kN PgDn .k1 - .k9 F1 - F9 .k0 F0 or F10 .k; F10 Macros: Simple macros can be made by comma seperating 2 or more command names. For example: eof,bol ^T Z Goto beginning of last line Also quoted matter is typed in literally: bol,">",dnarw .k1 Quote news article line Macros may cross lines if they end with , Commands or named macros may be created with :def. For example, you can use: :def foo eof,bol To define a command foo which will goto the beginning of the last line. :windows Bindings common to all windows type ^@ TO Type a character abort ^C Abort window arg ^[ \ Repeat next command explode ^[ I Show all windows or show only one window explode ^[ ^I explode ^[ i help ^G Help menu help .k1 hnext ^[ . Next help window hprev ^[ , Previous help window math ^[ m Calculator math ^[ M Calculator math ^[ ^M Calculator nextw ^[ N Goto next window nextw ^[ ^N nextw ^[ n pgdn .kN Screen down pgdn ^V pgdn ^[ [ 6 ~ pgup .kP Screen up pgup ^Y pgup ^[ [ 5 ~ play ^[ 0 TO 9 Execute macro prevw ^[ P Goto previous window prevw ^[ ^P prevw ^[ p query ^[ ? Macro query insert record ^[ ( Record a macro retype ^L Refresh screen rtn ^M Return shell ^[ z shell ^[ Z shell ^[ ^Z stop ^[ ) Stop recording :main Text editing window :inherit windows Spell-check macros Ispell :def ispellfile filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;cat ispell.tmp;/bin/rm ispell.tmp",rtn,retype :def ispellword psh,nextword,markk,prevword,markb,filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;tr -d $SPLTMP;aspell -x -c $SPLTMP /dev/tty;cat $SPLTMP;/bin/rm $SPLTMP",rtn,retype :def aspellword psh,nextword,markk,prevword,markb,filt,"SPLTMP=ispell.tmp;cat >$SPLTMP;aspell -x -c $SPLTMP /dev/tty;tr -d <$SPLTMP '\\012';/bin/rm $SPLTMP",rtn,retype,nextword aspellword ^T aspellfile ^[ T Spell check word aspellfile ^[ t aspellfile ^[ ^T insc ^[ [ 2 ~ insc ^[ [ L SCO delch ^[ [ 3 ~ pgup ^[ [ I SCO pgdn ^[ [ G SCO home ^[ [ 1 ~ Putty, Linux, Cygwin home ^[ [ H Xterm, Konsole, SCO home ^[ O H gnome-terminal home ^[ [ 7 ~ RxVT eol ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eol ^[ [ F Xterm, Konsole, SCO eol ^[ O F gnome-terminal eol ^[ [ 8 ~ RxVT ask,query,lose,query,abortbuf ^X Exit after many questions ask,query,exsave ^X Exit backs ^? Backspace backs ^H backw ^[ H Backspace word backw ^[ ^? backw ^[ ^H backw ^[ h bknd ^[ ' Shell window bof ^[ Y Goto beginning of file bof ^[ ^Y bof ^[ y home .kh Goto beginning of line home ^A home ^[ [ H home ^[ [ 1 ~ center ^[ ^C Center line center ^[ c delch .kD Delete character delch ^D deleol ^[ K Delete to end of line deleol ^[ ^K deleol ^[ k delw ^[ ^D Delete word delw ^[ d dnarw .kd Go down dnarw ^N dnarw ^[ O B dnarw ^[ [ B toggle_marking ^^ Marking edit ^[ E Edit a file edit ^[ ^E edit ^[ e eof ^[ V Go to end of file eof ^[ ^V eof ^[ v eol .kH Go to end of line eol .@7 eol ^E eol ^[ [ F eol ^[ [ 4 ~ execmd ^[ X Prompt for command to execute execmd ^[ ^X Prompt for command to execute execmd ^[ x Prompt for command to execute ffirst,uparw,eol ^W Find first ffirst ^W Find first fnext ^[ w fnext ^[ W filt ^[ / Filter block though file fmtblk ^J Format paragraphs in block groww ^[ G Grow window groww ^[ ^G groww ^[ g insc .kI Insert a space insf ^R Insert a file isrch ^[ S Forward incremental search isrch ^[ ^S Forward incremental search isrch ^[ s Forward incremental search line ^[ L Goto line no. line ^[ ^L line ^[ l line ^_ ltarw .kl Go left ltarw ^B ltarw ^[ O D ltarw ^[ [ D mode ^[ ^[ Options menu nextword ^@ Goto next word open ^] Split line prevword ^Z Previous word picokill ^K Pico kill function quote ` Enter Ctrl chars quote8 ^\ Enter Meta chars redo ^[ = Redo changes rsrch ^[ R Backward incremental search rsrch ^[ ^R Backward incremental search rsrch ^[ r Backward incremental search rtarw .kr Go right rtarw ^F rtarw ^[ O C rtarw ^[ [ C run ^[ ! Run a program in a window stat ^C Cursor position status blksave ^O Save file crawll ^[ < Pan left crawlr ^[ > Pan right shrinkw ^[ J Shrink window shrinkw ^[ ^J shrinkw ^[ j splitw ^[ ^O Split window splitw ^[ o tag ^[ ; Tags file search tomatch ^[ ] To matching delimiter undo ^[ - Undo changes uparw .ku Go up uparw ^P uparw ^[ O A uparw ^[ [ A yank ^U Paste yankpop ^[ U Select yanked text yankpop ^[ ^U yankpop ^[ u :prompt Prompt windows :inherit main abort ^C complete ^I cancel,bof ^Y cancel,eof ^V cancel,line ^T cancel,bop ^W cancel,eop ^O :menu Selection menus :inherit windows pgupmenu ^[ [ I pgdnmenu ^[ [ G bolmenu ^[ [ 1 ~ Putty, Linux, Cygwin bolmenu ^[ [ H Xterm, Konsole bolmenu ^[ O H gnome-terminal bolmenu ^[ [ 7 ~ RxVT eolmenu ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eolmenu ^[ [ F Xterm, Konsole eolmenu ^[ O F gnome-terminal eolmenu ^[ [ 8 ~ RxVT abort ^[ ^[ backsmenu ^? backsmenu ^H bofmenu ^K U bofmenu ^K ^U bofmenu ^K u bolmenu .kh bolmenu ^A dnarwmenu .kd dnarwmenu ^N dnarwmenu ^[ [ B dnarwmenu ^[ O B eofmenu ^K V eofmenu ^K ^V eofmenu ^K v eolmenu .kH eolmenu ^E ltarwmenu .kl ltarwmenu ^B ltarwmenu ^[ [ D ltarwmenu ^[ O D pgdnmenu .kN Screen down pgdnmenu ^V pgdnmenu ^[ [ 6 ~ pgupmenu .kP Screen up pgupmenu ^Y pgupmenu ^[ [ 5 ~ rtarwmenu .kr rtarwmenu ^F rtarwmenu ^[ [ C rtarwmenu ^[ O C rtn SP rtn ^I rtn ^K H rtn ^K h rtn ^K ^H tabmenu ^I uparwmenu .ku uparwmenu ^P uparwmenu ^[ [ A uparwmenu ^[ O A :query Single-key query window :inherit windows :querya Single-key query window for quoting type ^@ TO :querysr Search & replace query window type ^@ TO 070701001a7074000081a40000181b0000000a00000001452452bb00005663000000550000000100000000000000000000001a00000000reloc/sfw/etc/joe/jstarrc Initialization file for JOE WordStar / Turbo-C Joe JOE looks for this file in: 1 - $HOME/.jstarrc 2 - ${prefix}/etc/jstarrc This file can include other files by placing the following include command in the first column: :include filename FIRST SECTION: Default global options (these options can also be specified on the command line. Also the NOXON, LINES, COLUMNS, DOPADDING and BAUD options can be specified in environment variables): Put each option you want set in the first column: -option Sets the option --option Clears the option -mid Cursor is recentered when scrolling is necessary -marking Text between ^KB and cursor is highlighted (use with -lightoff) -asis Characters 128 - 255 shown as-is -force Force final newline when files are saved -nobackups If you don't want backup files to be created -lightoff Turn off highlighting after block copy or move -exask ^KX always confirms file name -beep Beep on errors and when cursor goes past extremes -nosta Disable top-most status line -keepup %k and %c status line escape sequences updated frequently -pg nnn No. lines to keep for PgUp/PgDn -csmode ^KF after a pervious search does a ^L instead -backpath path Directory to store backup files -nonotice Disable copyright notice -noxon Attempt to turn off ^S/^Q processing -orphan Put extra files given on command line in orphaned buffers instead of in windows -dopadding Output pad characters (for when there is no tty handshaking) -lines nnn Set no. screen lines -baud nnn Set baud rate for terminal optimizations -columns nnn Set no. screen columns -help Start with help on -skiptop nnn Don't use top nnn lines of the screen -notite Don't send terminal initialization and termination strings: prevents restoration of screen on exit. -usetabs Use tabs to help optimize screen update. -assume_color Assume terminal has ANSI color support even if termcap/terminfo entry says that it doesn't. This only applies if the terminal otherwise looks like an ANSI terminal (support bold and capability starts with ESC [). -guess_crlf Automatically detect MS-DOS files and set -crlf appropriately -guess_indent Guess indent character (tab or space). -menu_explorer Stay in menu system when a directory is selected (otherwise directory is added to path and menu is closed). -icase Search is case insensitive by default. -wrap Search wraps Status line definition strings. -lmsg defines the left-justified string and -rmsg defines the right-justified string. The first character of -rmsg is the background fill character. The following escape sequences can be used in these string: %t 12 hour time %u 24 hour time %T O for overtype mode, I for insert mode %W W if wordwrap is enabled %I A if autoindent is enabled %X Rectangle mode indicator %n File name %m '(Modified)' if file has been changed %* '*' if file has been changed %R Read-only indicator %r Row (line) number %c Column number %o Byte offset into file %O Byte offset into file in hex %a Ascii value of character under cursor %A Ascii value of character under cursor in hex %p Percent of file cursor is at %l No. lines in file %k Entered prefix keys %S '*SHELL*' if there is a shell running in window %M Macro recording message %y Syntax The formatting escape sequences may also be given: \i Inverse \u Underline \b Bold \d Dim \f Blink -lmsg \i%k%T%W%I%X %n %m%y%R %M -rmsg %S Row %r Col %c %t Ctrl-J for help SECOND SECTION: File name dependant local option settings: Each line with '*' in the first column indicates the modes which should be files which match the regular expression. If more than one regular expression matches the file name, than the last matching one is chosen. Here is a list of modes which can be set: -utf8 File is UTF-8 coded -syntax name Specify syntax (syntax file called 'name.jsf' will be loaded) -highlight Enable highlighting -smarthome Home key first moves cursor to beginning of line, then if hit again, to first non-blank character. -indentfirst Smart home goes to first non-blank character first, instead of going the beginning of line first. -smartbacks Backspace key deletes 'istep' number of 'indentc's if cursor is at first non-space character. -tab nnn Tab width -indentc nnn Indentation character (32 for space, 9 for tab) -istep nnn Number of indentation columns -spaces TAB inserts spaces instead of tabs. -purify Fix indentation if necessary for rindent, lindent and backs (for example if indentation uses a mix of tabs and spaces, and indentc is space, indentation will be converted to all spaces). -crlf File uses CR-LF at ends of lines -wordwrap Wordwrap -autoindent Auto indent -overwrite Overtype mode -picture Picture mode (right arrow can go past end of lines) -lmargin nnn Left margin -rmargin nnn Right margin -french One space after '.', '?' and '!' for wordwrap and paragraph reformat instead of two. Joe does not change the spacing you give, but sometimes it must put spacing in itself. This selects how much is inserted. -linums Enable line numbers on each line -rdonly File is read-only -keymap name Keymap to use if not 'main' -lmsg Status line definition strings- -rmsg see previous section for more info. -mnew macro Macro to execute when new files are loaded -mold macro Macro to execute when existing files are loaded -msnew macro Macro to execute when new files are saved -msold macro Macro to execute when existing files are saved -square Rectangular block mode Macros for the above options are in the same format as in the key binding section below- but without the key name strings. Default local options -highlight -istep 2 No '.' in file name? Assume it's a text file and we want wordwrap on. * -wordwrap File name with '.'? It's probably not a text file. *.* Diff * +--- -syntax diff * +*** -syntax diff * +\[1-9]\+\[0-9]\[cda] -syntax diff Assembly language *.asm -wordwrap -syntax asm *.s -wordwrap -syntax asm *.S -wordwrap -syntax asm Text file. *.txt -wordwrap Mason *.mas -autoindent -syntax mason -smarthome -smartbacks Perl * +#!\+\[ ]\+\[a-z/]/perl\> -autoindent -syntax perl -smarthome -smartbacks *.pl -autoindent -syntax perl -smarthome -smartbacks *.pm -autoindent -syntax perl -smarthome -smartbacks C language file *.c -autoindent -syntax c -smarthome -smartbacks -purify *.cpp -autoindent -syntax c -smarthome -smartbacks -purify *.c++ -autoindent -syntax c -smarthome -smartbacks -purify C language header file *.h -autoindent -syntax c -smarthome -smartbacks -purify *.hpp -autoindent -syntax c -smarthome -smartbacks -purify *.h++ -autoindent -syntax c -smarthome -smartbacks -purify Verilog file *.v -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify Verilog header file *.vh -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify VHDL file *.vhd -autoindent -syntax vhdl -istep 2 -smarthome -smartbacks -purify XML *.xml -wordwrap -autoindent -syntax xml HTML *.htm -wordwrap -autoindent -syntax html *.html -wordwrap -autoindent -syntax html JAVA *.java -autoindent -syntax java -smarthome -smartbacks -purify Hypertext preprocessor file *.php -autoindent -syntax php -smarthome -smartbacks -purify Python * +#!\+\[ ]\+\[a-z/]/python\> -autoindent -syntax python -smarthome -smartbacks -purify *.py -autoindent -syntax python -smarthome -smartbacks -purify CSH * +#!\+\[ ]\+\[a-z/]/csh\> -autoindent -syntax csh *.csh -autoindent -syntax csh *.cshrc -autoindent -syntax csh *.login -autoindent -syntax csh *.logout -autoindent -syntax csh TCSH * +#!\+\[ ]\+\[a-z/]/tcsh\> -autoindent -syntax csh *.tcsh -autoindent -syntax csh *.tcshrc -autoindent -syntax csh Shell * +#!\+\[ ]\+\[a-z/]/sh\> -autoindent -syntax sh *.sh -autoindent -syntax sh *profile -autoindent -syntax sh BASH Shell * +#!\+\[ ]\+\[a-z/]/bash\> -autoindent -syntax sh *.bash -autoindent -syntax sh *.bash_login -autoindent -syntax sh *.bash_logout -autoindent -syntax sh KSH * +#!\+\[ ]\+\[a-z/]/ksh\> -autoindent -syntax sh *.ksh -autoindent -syntax sh LISP *.lisp -autoindent -syntax lisp *.lsp -autoindent -syntax lisp *.el -autoindent -syntax el Makefile *akefile -autoindent -syntax conf *AKEFILE -autoindent -syntax conf Pascal *.p -autoindent -syntax pascal -smarthome -smartbacks -purify *.pas -autoindent -syntax pascal -smarthome -smartbacks -purify Fortran *.f -autoindent -syntax fortran *.for -autoindent -syntax fortran *.FOR -autoindent -syntax fortran YACC *.y -autoindent -syntax yacc LEX *.l -autoindent -syntax lex TCL *.tcl -autoindent -syntax tcl Joe Syntax File *.jsf -autoindent -syntax conf Autoconfig file *.ac -autoindent -syntax conf M4 file *.m4 -autoindent -syntax m4 Automake file *.am -autoindent -syntax conf Mail file *tmp/mutt-* -wordwrap -syntax mail THIRD SECTION: Named help screens: Use \i to turn on/off inverse video Use \u to turn on/off underline Use \b to turn on/off bold Use \d to turn on/off dim Use \f to turn on/off flash {Basic \i Help Screen \|turn off with ^J more help with ESC . (^[.) \i \i \i\|\uCURSOR\u \|\uGO TO\u \|\uBLOCK\u \|\uDELETE\u \|\uMISC\u \|\uEXIT\u \|\i \i \i \i\|^S left ^D right \|^R prev. screen \|^KB begin \|^G char \|^B reformat \|^KX save \|\i \i \i \i\|^E up ^X down \|^C next screen \|^KK end \|^Y line \|^V overtype \|^KQ abort \|\i \i \i \i\|^A previous word \|^QS beg. of line \|^KV move \|^T >word \|^] refresh \|^KZ shell \|\i \i \i \i\|^F next word \|^QD end of line \|^KC copy \|^QY >line \|^O options \|\uFILE\u \|\i \i \i \i\|\uSEARCH\u \|^QR top of file \|^KW file \|^U undo \|\uSPELL\u \|^KE new \|\i \i \i \i\|^QF find text \|^QC end of file \|^KY delete \|^^ redo \|^QN word \|^KR insert\|\i \i \i \i\|^L find next \|^QI to line No. \|^K/ filter \| \|^QL file \|^KD save \|\i \i } {Windows \i Help Screen \|turn off with ^J prev. screen ^[, next screen ^[. \i \i \i\|^KO Split the window in half \|^KE Load file into window \|\i \i \i \i\|^KG Make current window bigger \|^KT Make current window smaller \|\i \i \i \i\|^KN Go to the window below \|^KP Go to the window above \|\i \i \i \i\|^KQ Eliminate the current window \|^KI Show all windows / Show one window\|\i \i } {Advanced \i Help Screen \|turn off with ^J prev. screen ^[, next screen ^[. \i \i \i\|\uMACROS\u \|\uMISC\u \|\uSCROLL\u \|\uSHELL\u \|\uGOTO\u \|\uI-SEARCH\u \|\i \i \i \i\|^[( Record \|^Q? status \|^Q. Right \|^K' Window \|^QB to ^KB \|^[R Backwards \|\i \i \i \i\|^[) Stop \|^QQ repeat \|^Q, Left \|^[! Command \|^QK to ^KK \|^[S Forwards \|\i \i \i \i\|^[ 0-9 Play \|^QM Math \| \|\uQUOTE\u \|\uDELETE\u \|\uBOOKMARKS\u \|\i \i \i \i\|^[? Query \|^KA Center line \| \|^P Ctrl- \|^[Y yank \|^K 0-9 Set \|\i \i \i \i\|^[D Dump \|^[H Message \| \|^\\ Meta- \|^[O word< \|^Q 0-9 Goto \|\i \i } {Programs \i Help Screen \|turn off with ^J prev. screen ^[, next screen ^[. \i \i \i\|\uGOTO\u \|\uINDENT\u \|\uCOMPILING\u \| \|\i \i \i \i\|^Q[ Matching ( [ { \|^K. more \|^[C Compile and parse errors \| \|\i \i \i \i\|^QP Previous place \|^K, less \|^[E Parse errors \| \|\i \i \i \i\|^K= Next place \| \|^[= Goto next error \| \|\i \i \i \i\|^K; Tags file srch \| \|^[- Goto previous error \| \|\i \i } {Search \i Help Screen \|turn off with ^J prev. screen ^[, next screen ^[. \i \i \iSpecial search sequences: \|\i \i \i \i \\^ \\$ matches beg./end of line \\? match any single char \|\i \i \i \i \\< \\> matches beg./end of word \\* match 0 or more chars \|\i \i \i \i \\c matches balanced C expression \\\\ matches a \\ \|\i \i \i \i \\[..] matches one of a set \\n matches a newline \|\i \i \i \i \\+ matches 0 or more of the character which follows the \\+ \|\i \i \i \iSpecial replace sequences: \|\i \i \i \i \\& replaced with text which matched search string \|\i \i \i \i \\0 - 9 replaced with text which matched Nth \\*, \\?, \\c, \\+, or \\[..] \|\i \i \i \i \\\\ replaced with \\ \\n replaced with newline \|\i \i } {Names \i Help Screen \|turn off with ^J prev. screen ^[, next screen ^[. \i \i \i Hit TAB at file name prompts to generate menu of file names \|\i \i \i \i Or use up/down keys to access history of previously entered names \|\i \i \i \i Special file names: \|\i \i \i \i !command Pipe in/out of a shell command \|\i \i \i \i >>filename Append to a file \|\i \i \i \i - Read/Write to/from standard I/O \|\i \i \i \i filename,START,SIZE Read/Write a part of a file/device \|\i \i \i \i Give START/SIZE in decimal (255), octal (0377) or hex (0xFF) \|\i \i } {Joe \i Help Screen \|turn off with ^J prev. screen ^[, \i \i \i Send bug reports to: http://sourceforge.net/projects/joe-editor \|\i \i } FOURTH SECTION: Key bindings: Section names you must provide: :main For editing window :prompt For prompt lines :query For single-character query lines :querya Singe-character query for quote :querysr Search & Replace single-character query Other sections may be given as well for organization purposes or for use with the '-keymap' option. Use: :inherit name To copy the named section into the current one :delete key To delete a key sequence from the current section Keys: Use ^@ through ^_ and ^? for Ctrl chars Use SP for space Use a TO b to generate a range of characters You can also use termcap string capability names. For example: .ku Up .kd Down .kl Left .kr Right .kh Home .kH End .kI Insert .kD Delete .kP PgUp .kN PgDn .k1 - .k9 F1 - F9 .k0 F0 or F10 .k; F10 Macros: Simple macros can be made by comma seperating 2 or more command names. For example: bof,bol ^T Z Goto beginning of last line Also quoted matter is typed in literally: bol,">",dnarw .k1 Quote news article line Macros may cross lines if they end with , :windows Bindings common to all windows type ^@ TO abort ^K Q abort ^K ^Q abort ^K q abort ^C arg ^Q Q arg ^Q ^Q arg ^Q q explode ^K I explode ^K ^I explode ^K i help ^J nmark ^K H nmark ^K ^H nmark ^K h hnext ^[ . hprev ^[ , math ^Q M math ^Q ^M math ^Q m msg ^[ H msg ^[ ^H msg ^[ h nextw ^K N nextw ^K ^N nextw ^K n pgdn .kN Screen down pgdn ^[ [ 6 ~ pgup .kP Screen up pgup ^[ [ 5 ~ play ^[ 0 TO 9 prevw ^K P prevw ^K ^P prevw ^K p query ^[ ? record ^[ ( retype ^] rtn ^M shell ^K Z shell ^K ^Z shell ^K z stop ^[ ) :main Text editing window :inherit windows Ispell :def ispellfile filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;cat ispell.tmp;/bin/rm ispell.tmp",rtn,retype :def ispellword psh,nextword,markk,prevword,markb,filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;tr -d $SPLTMP;aspell -x -c $SPLTMP /dev/tty;cat $SPLTMP;/bin/rm $SPLTMP",rtn,retype :def aspellword psh,nextword,markk,prevword,markb,filt,"SPLTMP=ispell.tmp;cat >$SPLTMP;aspell -x -c $SPLTMP /dev/tty;tr -d <$SPLTMP '\\012';/bin/rm $SPLTMP",rtn,retype,nextword aspellfile ^Q l aspellfile ^Q L aspellfile ^Q ^L aspellword ^Q n aspellword ^Q N aspellword ^Q ^N Compile macro :def compile querysave,query,scratch,"* Build Log *",rtn,markb,eof," ",markk,blkdel,build insc ^[ [ 2 ~ insc ^[ [ L SCO delch ^[ [ 3 ~ pgup ^[ [ I SCO pgdn ^[ [ G SCO home ^[ [ 1 ~ Putty, Linux, Cygwin home ^[ [ H Xterm, Konsole, SCO home ^[ O H gnome-terminal home ^[ [ 7 ~ RxVT eol ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eol ^[ [ F Xterm, Konsole, SCO eol ^[ O F gnome-terminal eol ^[ [ 8 ~ RxVT rtarw,prevword,markb,nextword,markk ^K T rtarw,prevword,markb,nextword,markk ^K ^T rtarw,prevword,markb,nextword,markk ^K t run ^[ ! isrch ^[ s isrch ^[ S isrch ^[ ^S rsrch ^[ r rsrch ^[ R rsrch ^[ ^R backw ^[ o backw ^[ ^O yankpop ^[ y yankpop ^[ Y yankpop ^[ ^Y parserr ^[ E parserr ^[ ^E parserr ^[ e nxterr ^[ = prverr ^[ - compile ^[ ^C compile ^[ c compile ^[ C insf,"!date '+%I:%M %p'",rtn ^[ ! insf,"!date '+%b %d, %Y'",rtn ^[ @ center ^[ c psh,prevword,nextword,nextword,markk,prevword,markb,setmark,":", prevword,nextword,blkmove,markk,prevword,markb,gomark,":",blkmove,nextword ^[ t bop ^[ p psh,drop,fwrdc,query,markk,blkdel ^Q T Cut to char psh,drop,fwrdc,query,markk,blkdel ^Q t Cut to char psh,drop,fwrdc,query,markk,blkdel ^Q ^T Cut to char quote8 ^\ Quote Meta chars quote ^P Quote Ctrl chars backs ^? Backspace backs ^H bknd ^K ' Shell window bkwdc ^Q H ^@ TO bkwdc ^Q ^H ^@ TO bkwdc ^Q h ^@ TO blkcpy ^K C Copy marked block blkcpy ^K ^C blkcpy ^K c blkdel ^K Y Delete marked block blkdel ^K ^Y blkdel ^K y blkmove ^K V Move marked block blkmove ^K ^V blkmove ^K v blksave ^K W Save marked block blksave ^K ^W blksave ^K w bof ^Q R Goto beginning of file bof ^Q ^R bof ^Q r bof ^Q .kP home .kh Goto beginning of line home ^[ [ H home ^[ [ 1 ~ home ^Q S home ^Q ^S home ^Q s home ^Q .kl crawll ^Q , crawlr ^Q . tos,bol ^Q E tos,bol ^Q ^E tos,bol ^Q e tos,bol ^Q .ku center ^K A Center line center ^K ^A center ^K a delbol ^Q ^H delbol ^Q ^? delbol ^Q .kD delch .kD Delete character delch ^G deleol ^Q Y Delete to end of line deleol ^Q ^Y deleol ^Q y dellin ^Y Delete entire line delw ^T Delete word to right dnarw .kd Go down dnarw ^X dnarw ^[ O B dnarw ^[ [ B dnslide ^Z edit ^K E Edit a file edit ^K ^E edit ^K e eof ^Q C Go to end of file eof ^Q ^C eof ^Q c eof ^Q .kN eol .kH Go to end of line eol .@7 eol ^[ [ F eol ^[ [ 4 ~ eol ^Q D eol ^Q ^D eol ^Q d eol ^Q .kr bos,eol ^Q X bos,eol ^Q ^X bos,eol ^Q x bos,eol ^Q .kd exsave ^K X Save and exit exsave ^K ^X exsave ^K x ffirst ^Q F Find first ffirst ^Q ^F ffirst ^Q f qrepl ^Q A Search & replace qrepl ^Q ^A qrepl ^Q a filt ^K / Filter block fnext ^L Find next format ^B Format paragraph fwrdc ^Q G ^@ TO fwrdc ^Q ^G ^@ TO fwrdc ^Q g ^@ TO gomark ^Q 0 TO 9 groww ^K G Grow window groww ^K ^G groww ^K g insc ^@ insf ^K R Insert a file insf ^K ^R insf ^K r macros ^[ d Dump macros macros ^[ ^D mode,"T" ^V Insert/Overtype mode,"T" .kI lindent ^K , Indent to left line ^Q I Goto line no. line ^Q ^I line ^Q i ltarw .kl Go left ltarw ^S ltarw ^[ O D ltarw ^[ [ D markb ^K B Set beginning of marked block markb ^K ^B markb ^K b markk ^K K Set end of marked block markk ^K ^K markk ^K k markl ^K L markl ^K ^L markl ^K l mode ^O nextpos ^K = Goto next position in position history nextword ^F Goto next word open ^N Split line pgdn ^C pgup ^R prevpos ^Q P prevpos ^Q ^P prevpos ^Q p prevword ^A Previous word redo ^^ Redo changes rindent ^K . Indent to right rtarw .kr Go right rtarw ^D rtarw ^[ O C rtarw ^[ [ C save ^K D Save file save ^K S save ^K ^D save ^K ^S save ^K d save ^K s setmark ^K 0 TO 9 shrinkw ^K T Shrink window shrinkw ^K ^T shrinkw ^K t splitw ^K O Split window splitw ^K ^O splitw ^K o stat ^Q ? Show status tag ^K ; tomarkb ^Q B Go to beginning of marked block tomarkb ^Q ^B tomarkb ^Q b tomarkk ^Q K Go to end of marked block tomarkk ^Q ^K tomarkk ^Q k tomatch ^Q [ Goto matching parenthasis tomatch ^Q ^[ tomatch ^Q ] tomatch ^Q ^] undo ^U Undo changes undo ^_ uparw .ku Go up uparw ^E uparw ^[ O A uparw ^[ [ A upslide ^W :prompt Prompt windows :inherit main abort ^C complete ^I :menu Selection menus :inherit windows pgupmenu ^[ [ I pgdnmenu ^[ [ G bolmenu ^[ [ 1 ~ Putty, Linux, Cygwin bolmenu ^[ [ H Xterm, Konsole bolmenu ^[ O H gnome-terminal bolmenu ^[ [ 7 ~ RxVT eolmenu ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eolmenu ^[ [ F Xterm, Konsole eolmenu ^[ O F gnome-terminal eolmenu ^[ [ 8 ~ RxVT abort ^[ ^[ backsmenu ^? backsmenu ^H bofmenu ^Q R bofmenu ^Q ^R bofmenu ^K r bolmenu .kh bolmenu ^Q S bolmenu ^Q ^S bolmenu ^Q s dnarwmenu .kd dnarwmenu ^X dnarwmenu ^[ [ B dnarwmenu ^[ O B eofmenu ^Q C eofmenu ^Q ^C eofmenu ^Q c eolmenu .kH eolmenu ^Q D eolmenu ^Q ^D eolmenu ^Q d ltarwmenu .kl ltarwmenu ^S ltarwmenu ^[ [ D ltarwmenu ^[ O D pgdnmenu .kN Screen down pgdnmenu ^C pgdnmenu ^[ [ 6 ~ pgupmenu .kP Screen up pgupmenu ^R pgupmenu ^[ [ 5 ~ rtarwmenu .kr rtarwmenu ^D rtarwmenu ^[ [ C rtarwmenu ^[ O C rtn SP rtn ^I rtn ^K H rtn ^K h rtn ^K ^H rtn ^J tabmenu ^I uparwmenu .ku uparwmenu ^E uparwmenu ^[ [ A uparwmenu ^[ O A :query Single-key query window :inherit windows :querya Single-key query window for quoting type ^@ TO :querysr Search & replace query window type ^@ TO 070701001a7075000081a40000181b0000000a00000001452452bb00005815000000550000000100000000000000000000001900000000reloc/sfw/etc/joe/rjoerc Initialization file for JOE Restricted access Joe JOE looks for this file in: 1 - $HOME/.rjoerc 2 - ${prefix}/etc/rjoerc This file can include other files by placing the following include command in the first column: :include filename FIRST SECTION: Default global options (these options can also be specified on the command line. Also the NOXON, LINES, COLUMNS, DOPADDING and BAUD options can be specified in environment variables): Put each option you want set in the first column: -option Sets the option --option Clears the option -mid Cursor is recentered when scrolling is necessary -marking Text between ^KB and cursor is highlighted (use with -lightoff) -asis Characters 128 - 255 shown as-is -force Force final newline when files are saved -nobackups If you don't want backup files to be created -lightoff Turn off highlighting after block copy or move -exask ^KX always confirms file name -beep Beep on errors and when cursor goes past extremes -nosta Disable top-most status line -keepup %k and %c status line escape sequences updated frequently -pg nnn No. lines to keep for PgUp/PgDn -csmode ^KF after a pervious search does a ^L instead -backpath path Directory to store backup files -nonotice Disable copyright notice -noxon Attempt to turn off ^S/^Q processing -orphan Put extra files given on command line in orphaned buffers instead of in windows -dopadding Output pad characters (for when there is no tty handshaking) -lines nnn Set no. screen lines -baud nnn Set baud rate for terminal optimizations -columns nnn Set no. screen columns -help Start with help on -skiptop nnn Don't use top nnn lines of the screen -notite Don't send terminal initialization and termination strings: prevents restoration of screen on exit. -usetabs Use tabs to help optimize screen update. -assume_color Assume terminal has ANSI color support even if termcap/terminfo entry says that it doesn't. This only applies if the terminal otherwise looks like an ANSI terminal (support bold and capability starts with ESC [). -guess_crlf Automatically detect MS-DOS files and set -crlf appropriately -guess_indent Guess indent character (tab or space). -menu_explorer Stay in menu system when a directory is selected (otherwise directory is added to path and menu is closed). -icase Search is case insensitive by default. -wrap Search wraps Status line definition strings. -lmsg defines the left-justified string and -rmsg defines the right-justified string. The first character of -rmsg is the background fill character. The following escape sequences can be used in these strings: %t 12 hour time %u 24 hour time %T O for overtype mode, I for insert mode %W W if wordwrap is enabled %I A if autoindent is enabled %X Rectangle mode indicator %n File name %m '(Modified)' if file has been changed %* '*' if file has been changed %R Read-only indicator %r Row (line) number %c Column number %o Byte offset into file %O Byte offset into file in hex %a Ascii value of character under cursor %A Ascii value of character under cursor in hex %p Percent of file cursor is at %l No. lines in file %k Entered prefix keys %S '*SHELL*' if there is a shell running in window %M Macro recording message %y Syntax These formatting escape sequences may also be given: \i Inverse \u Underline \b Bold \d Dim \f Blink -lmsg \i%k%T%W%I%X %n %m%y%R %M -rmsg %S Row %r Col %c %t Ctrl-K H for help SECOND SECTION: File name dependant local option settings: Each line with '*' in the first column indicates the modes which should be set for files which match the regular expression. If more than one regular expression matches the file name, then the last matching one is chosen. Here are the modes which can be set: -utf8 File is UTF-8 coded -syntax name Specify syntax (syntax file called 'name.jsf' will be loaded) -highlight Enable highlighting -smarthome Home key first moves cursor to beginning of line, then if hit again, to first non-blank character. -indentfirst Smart home goes to first non-blank character first, instead of going the beginning of line first. -smartbacks Backspace key deletes 'istep' number of 'indentc's if cursor is at first non-space character. -tab nnn Tab width -indentc nnn Indentation character (32 for space, 9 for tab) -istep nnn Number of indentation columns -spaces TAB inserts spaces instead of tabs. -purify Fix indentation if necessary for rindent, lindent and backs (for example if indentation uses a mix of tabs and spaces, and indentc is space, indentation will be converted to all spaces). -crlf File uses CR-LF at ends of lines -wordwrap Wordwrap -autoindent Auto indent -overwrite Overtype mode -picture Picture mode (right arrow can go past end of lines) -lmargin nnn Left margin -rmargin nnn Right margin -french One space after '.', '?' and '!' for wordwrap and paragraph reformat instead of two. Joe does not change the spacing you give, but sometimes it must put spacing in itself. This selects how much is inserted. -linums Enable line numbers on each line -rdonly File is read-only -keymap name Keymap to use if not 'main' -lmsg Status line definition strings- -rmsg see previous section for more info. -mnew macro Macro to execute when new files are loaded -mold macro Macro to execute when existing files are loaded -msnew macro Macro to execute when new files are saved -msold macro Macro to execute when existing files are saved -square Rectangular block mode Macros for the above options are in the same format as in the key binding section below- but without the key name strings. Default local options -highlight -istep 2 No '.' in file name? Assume it's a text file and we want wordwrap on. * -wordwrap File name with '.'? It's probably not a text file. *.* Diff * +--- -syntax diff * +*** -syntax diff * +\[1-9]\+\[0-9]\[cda] -syntax diff Text file. *.txt -wordwrap Assembly language *.asm -wordwrap -syntax asm *.s -wordwrap -syntax asm *.S -wordwrap -syntax asm Mason *.mas -autoindent -syntax mason -smarthome -smartbacks Perl * +#!\+\[ ]\+\[a-z/]/perl\> -autoindent -syntax perl -smarthome -smartbacks *.pl -autoindent -syntax perl -smarthome -smartbacks *.pm -autoindent -syntax perl -smarthome -smartbacks C language file *.c -autoindent -syntax c -smarthome -smartbacks -purify *.cpp -autoindent -syntax c -smarthome -smartbacks -purify *.c++ -autoindent -syntax c -smarthome -smartbacks -purify C language header file *.h -autoindent -syntax c -smarthome -smartbacks -purify *.hpp -autoindent -syntax c -smarthome -smartbacks -purify *.h++ -autoindent -syntax c -smarthome -smartbacks -purify Verilog file *.v -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify Verilog header file *.vh -autoindent -syntax verilog -istep 2 -smarthome -smartbacks -purify VHDL file *.vhd -autoindent -syntax vhdl -istep 2 -smarthome -smartbacks -purify XML *.xml -wordwrap -autoindent -syntax xml HTML *.htm -wordwrap -autoindent -syntax html *.html -wordwrap -autoindent -syntax html JAVA *.java -autoindent -syntax java -smarthome -smartbacks -purify Hypertext preprocessor file *.php -autoindent -syntax php -smarthome -smartbacks -purify Python * +#!\+\[ ]\+\[a-z/]/python\> -autoindent -syntax python -smarthome -smartbacks -purify *.py -autoindent -syntax python -smarthome -smartbacks -purify CSH * +#!\+\[ ]\+\[a-z/]/csh\> -autoindent -syntax csh *.csh -autoindent -syntax csh *.cshrc -autoindent -syntax csh *.login -autoindent -syntax csh *.logout -autoindent -syntax csh TCSH * +#!\+\[ ]\+\[a-z/]/tcsh\> -autoindent -syntax csh *.tcsh -autoindent -syntax csh *.tcshrc -autoindent -syntax csh Shell * +#!\+\[ ]\+\[a-z/]/sh\> -autoindent -syntax sh *.sh -autoindent -syntax sh *profile -autoindent -syntax sh BASH Shell * +#!\+\[ ]\+\[a-z/]/bash\> -autoindent -syntax sh *.bash -autoindent -syntax sh *.bash_login -autoindent -syntax sh *.bash_logout -autoindent -syntax sh LISP *.lisp -autoindent -syntax lisp *.lsp -autoindent -syntax lisp *.el -autoindent -syntax lisp KSH * +#!\+\[ ]\+\[a-z/]/ksh\> -autoindent -syntax sh *.ksh -autoindent -syntax sh Makefile *akefile -autoindent -syntax conf *AKEFILE -autoindent -syntax conf Pascal *.p -autoindent -syntax pascal -smarthome -smartbacks -purify *.pas -autoindent -syntax pascal -smarthome -smartbacks -purify Fortran *.f -autoindent -syntax fortran *.for -autoindent -syntax fortran *.FOR -autoindent -syntax fortran YACC *.y -autoindent -syntax yacc LEX *.l -autoindent -syntax lex TCL *.tcl -autoindent -syntax tcl Joe Syntax File *.jsf -autoindent -syntax conf Autoconfig file *.ac -autoindent -syntax conf M4 file *.m4 -autoindent -syntax m4 Automake file *.am -autoindent -syntax conf Mail file *tmp/mutt-* -wordwrap -syntax mail THIRD SECTION: Named help screens: Use \i to turn on/off inverse video Use \u to turn on/off underline Use \b to turn on/off bold Use \d to turn on/off dim Use \f to turn on/off flash {Basic \i Help Screen \|turn off with ^KH more help with ESC . (^[.) \i \i \i\|\uCURSOR\u \|\uGO TO\u \|\uBLOCK\u \|\uDELETE\u \|\uMISC\u \|\uEXIT\u \|\i \i \i \i\|^B left ^F right \|^U prev. screen \|^KB begin \|^D char. \|^KJ reformat \|^KX save \|\i \i \i \i\|^P up ^N down \|^V next screen \|^KK end \|^Y line \|^T options \|^C abort \|\i \i \i \i\|^Z previous word \|^A beg. of line \|^KM move \|^W >word \|^R refresh \| \|\i \i \i \i\|^X next word \|^E end of line \|^KC copy \|^O word< \|^@ insert \|\uFILE\u \|\i \i \i \i\|\uSEARCH\u \|^KU top of file \|^KY delete \|^J >line \|\uSPELL\u \|^KD save \|\i \i \i \i\|^KF find text \|^KV end of file \| \|^_ undo \|^[N word \| \|\i \i \i \i\|^L find next \|^KL to line No. \| \|^^ redo \|^[L file \| \|\i \i } {Windows \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i\|^KO Split the window in half \| \|\i \i \i \i\|^KG Make current window bigger \|^KT Make current window smaller \|\i \i \i \i\|^KN Go to the window below \|^KP Go to the window above \|\i \i \i \i\|^C Eliminate the current window \|^KI Show all windows / Show one window\|\i \i } {Advanced \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i\|\uMACROS\u \|\uMISC\u \|\uSCROLL\u \| \|\uGOTO\u \|\uI-SEARCH\u \|\i \i \i \i\|^K[ 0-9 Record \|^K SPACE status \|^[W Up \| \|^[B To ^KB \|^[R Backwards\|\i \i \i \i\|^K] Stop \|^K\\ Repeat \|^[Z Down \| \|^[K To ^KK \|^[S Forwards \|\i \i \i \i\|^K 0-9 Play \|^[M Math \|^K< Left \|\uQUOTE\u \|\uDELETE\u \|\uBOOKMARKS\u \|\i \i \i \i\|^K? Query \|^KA Center line \|^K> Right \|` Ctrl- \|^[Y yank \|^[ 0-9 Goto \|\i \i \i \i\|^[D Dump \|^[H Message \| \|^\\ Meta- \|^[O line< \|^[^[ Set \|\i \i } {Programs \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \i\|\uGOTO\u \|\uINDENT\u \|\i \i \i \i\|^G Matching ( [ { \|^K, less \|\i \i \i \i\|^K- Previous place \|^K. more \|\i \i \i \i\|^K= Next place \| \|\i \i } {Search \i Help Screen \|turn off with ^KH prev. screen ^[, next screen ^[. \i \i \iSpecial search sequences: \|\i \i \i \i \\^ \\$ matches beg./end of line \\? match any single char \|\i \i \i \i \\< \\> matches beg./end of word \\* match 0 or more chars \|\i \i \i \i \\c matches balanced C expression \\\\ matches a \\ \|\i \i \i \i \\[..] matches one of a set \\n matches a newline \|\i \i \i \i \\+ matches 0 or more of the character which follows the \\+ \|\i \i \i \iSpecial replace sequences: \|\i \i \i \i \\& replaced with text which matched search string \|\i \i \i \i \\0 - 9 replaced with text which matched Nth \\*, \\?, \\c, \\+, or \\[..] \|\i \i \i \i \\\\ replaced with \\ \\n replaced with newline \|\i \i } {Joe \i Help Screen \|turn off with ^KH prev. screen ^[, \i \i \i Send bug reports to: http://sourceforge.net/projects/joe-editor \|\i \i } FOURTH SECTION: Key bindings: Section names you must provide: :main For editing window :prompt For prompt lines :query For single-character query lines :querya Singe-character query for quote :querysr Search & Replace single-character query Other sections may be given as well for organization purposes or for use with the '-keymap' option. Use: :inherit name To copy the named section into the current one :delete key To delete a key sequence from the current section Keys: Use ^@ through ^_ and ^? for Ctrl chars Use SP for space Use a TO b to generate a range of characters You can also use termcap string capability names. For example: .ku Up .kd Down .kl Left .kr Right .kh Home .kH End .kI Insert .kD Delete .kP PgUp .kN PgDn .k1 - .k9 F1 - F9 .k0 F0 or F10 .k; F10 Macros: Simple macros can be made by comma seperating 2 or more command names. For example: bof,bol ^T Z Goto beginning of last line Also quoted matter is typed in literally: bol,">",dnarw .k1 Quote news article line Macros may cross lines if they end with , :windows Bindings common to all windows type ^@ TO Type a character abort ^C Abort window abort ^K Q abort ^K ^Q abort ^K q arg ^K \ Repeat next command explode ^K I Show all windows or show only one window explode ^K ^I explode ^K i help ^K H Help menu help ^K ^H help ^K h hnext ^[ . Next help window hprev ^[ , Previous help window math ^[ m Calculator math ^[ M Calculator math ^[ ^M Calculator msg ^[ h Display a message msg ^[ H Display a message msg ^[ ^H Display a message nextw ^K N Goto next window nextw ^K ^N nextw ^K n pgdn .kN Screen down pgdn ^V pgdn ^[ [ 6 ~ pgup .kP Screen up pgup ^U pgup ^[ [ 5 ~ play ^K 0 TO 9 Execute macro prevw ^K P Goto previous window prevw ^K ^P prevw ^K p query ^K ? Macro query insert record ^K [ Record a macro retype ^R Refresh screen rtn ^M Return shell ^K Z Shell escape shell ^K ^Z shell ^K z stop ^K ] Stop recording :main Text editing window :inherit windows Spell-check macros Ispell :def ispellfile filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;cat ispell.tmp;/bin/rm ispell.tmp",rtn,retype :def ispellword psh,nextword,markk,prevword,markb,filt,"cat >ispell.tmp;ispell ispell.tmp /dev/tty;tr -d $SPLTMP;aspell -x -c $SPLTMP /dev/tty;cat $SPLTMP;/bin/rm $SPLTMP",rtn,retype :def aspellword psh,nextword,markk,prevword,markb,filt,"SPLTMP=ispell.tmp;cat >$SPLTMP;aspell -x -c $SPLTMP /dev/tty;tr -d <$SPLTMP '\\012';/bin/rm $SPLTMP",rtn,retype,nextword aspellfile ^[ l aspellword ^[ n insc ^[ [ 2 ~ insc ^[ [ L SCO delch ^[ [ 3 ~ pgup ^[ [ I SCO pgdn ^[ [ G SCO home ^[ [ 1 ~ Putty, Linux, Cygwin home ^[ [ H Xterm, Konsole, SCO home ^[ O H gnome-terminal home ^[ [ 7 ~ RxVT eol ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eol ^[ [ F Xterm, Konsole, SCO eol ^[ O F gnome-terminal eol ^[ [ 8 ~ RxVT Extra functions not really part of JOE user interface: delbol ^[ o Delete to beginning of line delbol ^[ ^O Delete to beginning of line dnslide ^[ z Scroll down one line dnslide ^[ Z Scroll down one line dnslide ^[ ^Z Scroll down one line switch,rtn,filt, query,parserr ^[ c Compile switch,rtn,filt, query,parserr ^[ C Compile switch,rtn,filt, query,parserr ^[ ^C Compile execmd ^[ x Prompt for command to execute execmd ^[ X Prompt for command to execute execmd ^[ ^X Prompt for command to execute isrch ^[ s Forward incremental search isrch ^[ S Forward incremental search isrch ^[ ^S Forward incremental search notmod ^[ ~ Not modified nxterr ^[ = To next error parserr ^[ e Parse errors in current buffer parserr ^[ E Parse errors in current buffer parserr ^[ ^E Parse errors in current buffer prverr ^[ - To previous error rsrch ^[ r Backward incremental search rsrch ^[ R Backward incremental search rsrch ^[ ^R Backward incremental search run ^[ ! Run a program in a window tomarkb ^[ b Go to beginning of marked block tomarkb ^[ ^B Go to beginning of marked block tomarkk ^[ k Go to end of marked block tomarkk ^[ ^K Go to end of marked block tomarkk ^[ K Go to end of marked block txt ^[ i Prompt for text and insert it txt ^[ ^I Prompt for text and insert it txt ^[ I Prompt for text and insert it upslide ^[ w Scroll up one line upslide ^[ ^W Scroll up one line upslide ^[ W Scroll up one line yankpop ^[ y Undelete text yankpop ^[ ^Y Undelete text yankpop ^[ Y Undelete text bufed ^[ d Menu of buffers pbuf ^[ . Next buffer nbuf ^[ , Prev buffer query ^[ q Quoted insert byte ^[ n Goto byte col ^[ c Goto column abortbuf ^[ k Kill current buffer- don't mess with windows ask ^[ a Ask to save current buffer bop ^[ p Backwards paragraph bos ^[ x Bottom of screen copy ^[ ^W Copy block into yank dupw ^[ \ Split window eop ^[ n Forwards paragraph format ^[ j Format paragraph ignore block markl ^[ l Mark line nmark ^[ @ Turn off ^KB ^KK pop ^[ > Pop ^KB ^KK psh ^[ < Push ^KB ^KK swap ^[ x Swap ^KB and cursor tomarkbk ^[ g Switch between beginning and end of marked tos ^[ e Top of screen tw0 ^[ 0 Kill current window (orphans buffer) tw1 ^[ 1 Kill all other windows (orphans buffers) uarg ^[ u Universal argument yank ^[ ^Y Undelete previous text yapp ^[ w Append next delete to previous yank Standard JOE user interface quote8 ^\ Enter Meta chars quote ` Enter Ctrl chars backs ^? Backspace backs ^H backw ^O Backspace word bknd ^K ' Shell window blkcpy ^K C Copy marked block blkcpy ^K ^C blkcpy ^K c blkdel ^K Y Delete marked block blkdel ^K ^Y blkdel ^K y blkmove ^K M Move marked block blkmove ^K ^M blkmove ^K m blksave ^K W Save marked block blksave ^K ^W blksave ^K w bof ^K U Goto beginning of file bof ^K ^U bof ^K u bol .kh Goto beginning of line bol ^A bol ^[ [ H bol ^[ [ 1 ~ center ^K A Center line center ^K ^A center ^K a crawll ^K < Pan left crawlr ^K > Pan right delch .kD Delete character delch ^D deleol ^J Delete to end of line dellin ^Y Delete entire line delw ^W Delete word to right dnarw .kd Go down dnarw ^N dnarw ^[ O B dnarw ^[ [ B edit ^K E Edit a file edit ^K ^E edit ^K e eof ^K V Go to end of file eof ^K ^V eof ^K v eol .kH Go to end of line eol ^E eol ^[ [ F eol ^[ [ 4 ~ exsave ^K X Save and exit exsave ^K ^X exsave ^K x ffirst ^K F Find first ffirst ^K ^F ffirst ^K f filt ^K / Filter block fnext ^L Find next fmtblk ^K J Format paragraphs in block fmtblk ^K ^J fmtblk ^K j gomark ^[ 0 TO 9 Goto bookmark groww ^K G Grow window groww ^K ^G groww ^K g insc .kI Insert a space insc ^@ insf ^K R Insert a file insf ^K ^R insf ^K r lindent ^K , Indent to left line ^K L Goto line no. line ^K ^L line ^K l ltarw .kl Go left ltarw ^B ltarw ^[ O D ltarw ^[ [ D macros ^[ d Dump keyboard macros macros ^[ ^D markb ^K B Set beginning of marked block markb ^K ^B markb ^K b markk ^K K Set end of marked block markk ^K ^K markk ^K k mode ^T Options menu nextpos ^K = Goto next position in position history nextword ^X Goto next word open ^] Split line prevpos ^K - Previous position in history prevword ^Z Previous word redo ^^ Redo changes rindent ^K . Indent to right rtarw .kr Go right rtarw ^F rtarw ^[ O C rtarw ^[ [ C ask ^K D Save file- no prompt ask ^K S ask ^K ^D ask ^K ^S ask ^K d ask ^K s save ^K D Save file save ^K S save ^K ^D save ^K ^S save ^K d save ^K s setmark ^[ ^[ Set bookmark shrinkw ^K T Shrink window shrinkw ^K ^T shrinkw ^K t splitw ^K O Split window splitw ^K ^O splitw ^K o stat ^K SP Show status tag ^K ; Tags file search tomatch ^G Goto matching parenthasis undo ^_ Undo changes uparw .ku Go up uparw ^P uparw ^[ O A uparw ^[ [ A :prompt Prompt windows :inherit main complete ^I :menu Selection menus :inherit windows pgupmenu ^[ [ I pgdnmenu ^[ [ G bolmenu ^[ [ 1 ~ Putty, Linux, Cygwin bolmenu ^[ [ H Xterm, Konsole bolmenu ^[ O H gnome-terminal bolmenu ^[ [ 7 ~ RxVT eolmenu ^[ [ 4 ~ Putty, Linux, Cygwin, ssh eolmenu ^[ [ F Xterm, Konsole eolmenu ^[ O F gnome-terminal eolmenu ^[ [ 8 ~ RxVT abort ^[ ^[ backsmenu ^? backsmenu ^H bofmenu ^K U bofmenu ^K ^U bofmenu ^K u bolmenu .kh bolmenu ^A dnarwmenu .kd dnarwmenu ^N dnarwmenu ^[ [ B dnarwmenu ^[ O B eofmenu ^K V eofmenu ^K ^V eofmenu ^K v eolmenu .kH eolmenu ^E ltarwmenu .kl ltarwmenu ^B ltarwmenu ^[ [ D ltarwmenu ^[ O D pgdnmenu .kN Screen down pgdnmenu ^V pgdnmenu ^[ [ 6 ~ pgupmenu .kP Screen up pgupmenu ^U pgupmenu ^[ [ 5 ~ rtarwmenu .kr rtarwmenu ^F rtarwmenu ^[ [ C rtarwmenu ^[ O C rtn SP rtn ^I rtn ^K H rtn ^K h rtn ^K ^H tabmenu ^I uparwmenu .ku uparwmenu ^P uparwmenu ^[ [ A uparwmenu ^[ O A :query Single-key query window :inherit windows :querya Single-key query window for quoting type ^@ TO :querysr Search & replace query window type ^@ TO 070701001a7076000041ed0000181b0000000a000000024525399200000000000000550000000100000000000000000000001900000000reloc/sfw/etc/joe/syntax070701001a7077000081a40000181b0000000a00000001452452bb00001046000000550000000100000000000000000000002100000000reloc/sfw/etc/joe/syntax/asm.jsf# JOE syntax highlight file for assembly language # Highlights ';' comments, C-preprocessor stuff and C-like constants. # Some assembly languages do not use C-preprocessor and use '#' for # comments. For them, eliminate all states up to ':idle'. and change the # ";" line in 'idle' to '#'. # For UNIX assembly ';' actually separates instructions, but I've only seen # this for 'rep; movsb'. If it bothers you eliminate the ';' line in # ':idle'. # This highlighter is too strict for numeric constants. Many assembly # languages allow '000009', which looks like a bad octal constant in C/UNIX. =Idle =Bad bold red =Preproc blue =Define bold blue =Comment green =IncLocal cyan =IncSystem bold cyan =Constant cyan =Escape bold cyan =Type bold =Keyword bold =CppKeyword bold =Brace =Control :reset Idle * first noeat " \t" reset :first Idle * idle noeat "#" pre recolor=-1 :pre Preproc * preproc noeat " \t" pre "a-z" preident recolor=-1 buffer :preident Preproc * preproc noeat strings "define" predef "include" preinc done "a-z" preident :preinc Preproc * preinc " \t" preinc_ws "\n" reset :preinc_ws Preproc * prebad recolor=-1 " \t" preinc_ws "\"" preinc_local recolor=-1 "<" preinc_system recolor=-1 :preinc_local IncLocal * preinc_local "\"\n" reset :preinc_system IncSystem * preinc_system ">\n" reset :prebad Bad * prebad "\n" reset :predef Preproc * predef " \t" predef_ws "\n" reset :predef_ws Preproc * prebad recolor=-1 " \t" predef_ws "a-zA-Z0-9_" predef_ident recolor=-1 :predef_ident Define * idle noeat "a-zA-Z0-9_" predef_ident :preproc Preproc * preproc "\n" reset "\\" preproc_cont "/" preproc_slash :preproc_slash Preproc * preproc noeat "*" comment recolor=-2 "/" line_comment recolor=-2 :preproc_cont Preproc * preproc_cont "\n" preproc # All following states are for when we're not in a preprocessor line :idle Idle * idle ";" line_comment recolor=-1 "\n" reset "/" slash "0" first_digit recolor=-1 "1-9" decimal recolor=-1 "." maybe_float "\"" string recolor=-1 "'" char recolor=-1 "a-zA-Z_" ident buffer "{}" brace recolor=-1 ",:=()><[]*&|!~+\-%^" control recolor=-1 :brace Brace * idle noeat :control Control * idle noeat :slash Idle * idle noeat recolor=-2 # Not sure about this "*" comment recolor=-2 "/" line_comment recolor=-2 :comment Comment * comment "*" maybe_end_comment :maybe_end_comment Comment * comment "/" idle "*" maybe_end_comment :line_comment Comment * line_comment "\n" reset :first_digit Constant * idle noeat "xX" hex "." float "eE" epart "0-7" octal "89" bad_number recolor=-1 :bad_number Bad * idle noeat "0-9" bad_number :octal Constant * idle noeat "0-7" octal "89" bad_number recolor=-1 :hex Constant * idle noeat "0-9A-Fa-f" hex :decimal Constant * idle noeat "0-9" decimal "eE" epart "." float :maybe_float Constant * idle recolor=-2 noeat "0-9" float recolor=-2 :float Constant * idle noeat "eE" epart "0-9" float :epart Constant * idle noeat "0-9+\-" enum :enum Constant * idle noeat "0-9" enum :string Constant * string "\"" idle "\\" string_escape recolor=-1 "%" string_control recolor=-1 :string_escape Escape * string "x" string_hex1 "0-7" string_octal2 "\n" string recolor=-2 :string_hex1 Escape * string noeat "0-9a-fA-F" string_hex2 :string_hex2 Escape * string noeat "0-9a-fA-F" string :string_octal2 Escape * string noeat "0-7" string_octal3 :string_octal3 Escape * string noeat "0-7" string :string_control Escape * string_control "\n" reset "diouxXeEfFgGaAcspn%SC" string :char Constant * char "\n" reset "'" idle "\\" char_escape recolor=-1 :char_escape Escape * char "x" char_hex1 "0-7" char_octal2 "\n" char recolor=-2 :char_hex1 Escape * char noeat "0-9a-fA-F" char_hex2 :char_hex2 Escape * char noeat "0-9a-fA-F" char :char_octal2 Escape * char noeat "0-7" char_octal3 :char_octal3 Escape * char noeat "0-7" char :ident Idle * idle noeat "a-zA-Z0-9_" ident 070701001a7078000081a40000181b0000000a00000001452452bb00001d84000000550000000100000000000000000000001f00000000reloc/sfw/etc/joe/syntax/c.jsf# JOE syntax highlight file for C and C++ # A (deterministic) state machine which performs lexical analysis of C. # (This is the "assembly language" of syntax highlighting. A separate # program could be used to convert a regular expression NFA syntax into this # format). # Each state begins with ': ' # is the color used for characters eaten by the state # (really a symbol for a user definable color). # The first state defined is the initial state. # Within a state, define transitions (jumps) to other states. Each # jump has the form: [